Citrus Sinensis ID: 021262


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
MATGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTIRPGHKWDVMVDLFFYREPEETKQAEEEETAAIDYATAEYNTNLTSGDQWPSQIADGGWAGGEVQKPIPGVPYFPEAPAATVPLGGDGWDAVPAPPMAAVTAPPMAAVTAPDVSAAPPPTGWD
cccccccccccccccHHHHHHHHHcccccccccccccccccEEEEEccccEEEEHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHccccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEcccccccccEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*************Q*EADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTIRPGHKWDVMVDLFFYREP************A****TAEYNTNLTSGDQWPSQIADGGWAGGEVQKPIPGVPYFPEAPAATVPLGGDGWDAVPAPPMAAVTAPPMAAVTA*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTIRPGHKWDVMVDLFFYREPEETKQAEEEETAAIDYATAEYNTNLTSGDQWPSQIADGGWAGGEVQKPIPGVPYFPEAPAATVPLGGDGWDAVPAPPMAAVTAPPMAAVTAPDVSAAPPPTGWD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein Sa-2 Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.confidentQ8H173
40S ribosomal protein SA Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.confidentA5BUU4
40S ribosomal protein SA Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.probableQ9ZSR8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain A
Confidence level:very confident
Coverage over the Query: 12-254
View the alignment between query and template
View the model in PyMOL