Citrus Sinensis ID: 021309

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MDNKREQNPSPVPKKTIPPYMKAVSGSLGGVVEACCLQPIDVIKTRLQLDTTGTYRGIIHCGATVSRTEGVRALWKGLTPFATHLTLKYTLRMGSNAVFQSAFKDSKTGKISNQGRLMAGFGAGVLEALAIVTPFEVVKIRLQQQRGLSPELLKYKGPIHCARMIIREEGLFGLWAGAAPTVMRNGTNQAAMFTAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRYLRNAPL
ccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccHHHcccccccccccccccccHHHHHHHHHHHHcHHHHHccccccEEEcccccHHHHHHHHHHHHHHHHHccccccc
*******************YMKAVSGSLGGVVEACCLQPIDVIKTRLQLDTTGTYRGIIHCGATVSRTEGVRALWKGLTPFATHLTLKYTLRMGSNAVFQSAFKDSKTGKISNQGRLMAGFGAGVLEALAIVTPFEVVKIRLQQQRGLSPELLKYKGPIHCARMIIREEGLFGLWAGAAPTVMRNGTNQAAMFTAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRYL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNKREQNPSPVPKKTIPPYMKAVSGSLGGVVEACCLQPIDVIKTRLQLDTTGTYRGIIHCGATVSRTEGVRALWKGLTPFATHLTLKYTLRMGSNAVFQSAFKDSKTGKISNQGRLMAGFGAGVLEALAIVTPFEVVKIRLQQQRGLSPELLKYKGPIHCARMIIREEGLFGLWAGAAPTVMRNGTNQAAMFTAKNAFDVLLWKKHEGDGKVLQPWQSMISGFLAGTAGPVCTGPFDVVKTRLMAQSRGGGELKYKGMVHAIRTIYAEEGLLALWKGLLPRLMRIPPGQAIMWAVADQVTGFYERRYLRNAPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial succinate-fumarate transporter 1 May transport cytoplasmic succinate, derived from fatty acid oxidation, into the mitochondrial matrix in exchange of fumarate during lipid mobilization in seed germination. Conversion of seed-reserved triacylglycerols into sucrose is necessary for growth before the onset of photosynthesis and involves fatty acid beta-oxidation, the glyoxylate cycle and gluconeogenesis.confidentQ9M038
Succinate/fumarate mitochondrial transporter Transports cytoplasmic succinate, derived from isocitrate by the action of isocitrate lyase in the cytosol, into the mitochondrial matrix in exchange for fumarate.probableP33303
Mitochondrial 2-oxodicarboxylate carrier Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate.probableQ5RFB7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 17-300
View the alignment between query and template
View the model in PyMOL