Query         021353
Match_columns 313
No_of_seqs    180 out of 791
Neff          5.1 
Searched_HMMs 46136
Date          Fri Mar 29 09:34:37 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/021353.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/021353hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist  99.9 8.5E-27 1.8E-31  195.8   5.7   97    4-114    31-129 (129)
  2 PF05865 Cypo_polyhedrin:  Cypo  18.3 1.2E+02  0.0027   27.7   3.1   26   66-91    142-168 (248)
  3 PF10534 CRIC_ras_sig:  Connect  12.6      69  0.0015   26.3   0.0   23  290-312    37-61  (95)
  4 PF06214 SLAM:  Signaling lymph  10.6 1.2E+02  0.0026   26.1   0.7   27   14-40     93-123 (126)
  5 PF01473 CW_binding_1:  Putativ   9.7 2.1E+02  0.0045   16.1   1.3    8   31-38      7-14  (19)
  6 PF07045 DUF1330:  Protein of u   9.3   2E+02  0.0043   21.2   1.5   17  296-312    41-58  (65)
  7 PF12043 DUF3527:  Domain of un   9.3 6.4E+02   0.014   25.4   5.4   84    9-117    23-109 (346)
  8 TIGR03116 cas_csf3 CRISPR-asso   9.1 2.2E+02  0.0047   26.6   1.9   22   51-76     94-115 (214)
  9 PRK10154 hypothetical protein;   8.5 3.5E+02  0.0076   23.6   2.8   21   86-109    80-100 (134)
 10 KOG4286 Dystrophin-like protei   8.0      89  0.0019   34.6  -1.2   50   81-132   613-675 (966)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=99.93  E-value=8.5e-27  Score=195.77  Aligned_cols=97  Identities=32%  Similarity=0.622  Sum_probs=69.5

Q ss_pred             cccccccccCCCCCCCCCCCCCCC-CCCCCeEEEeeecccccccCCcccccccCCCCCCCCCceEeecCCcceEEe-CCe
Q 021353            4 DEFIPTIEGDQGICYTHPENLPGA-KKDGSSVHFFHRTTNAYATGQRKRRKIQSEHSLNEEHVRWHKTGKTKPVIE-NGI   81 (313)
Q Consensus         4 d~fIptvd~d~dIy~~~PwdLPg~-~~~G~~wYFFs~~~~ky~~G~R~~R~t~~G~~~~~~~G~Wk~tGk~k~I~~-~g~   81 (313)
                      .++|+++|    ||.+|||+||.. ...++.||||+++.+++.+|.|++|++++        |+||++|+.++|.. +|.
T Consensus        31 ~~~i~~~D----iy~~~P~~L~~~~~~~~~~~yFF~~~~~~~~~~~r~~R~~~~--------G~Wk~~g~~~~i~~~~g~   98 (129)
T PF02365_consen   31 EDVIHDVD----IYSAHPWELPAKFKGGDEEWYFFSPRKKKYPNGGRPNRVTGG--------GYWKSTGKEKPIKDPGGK   98 (129)
T ss_dssp             -CHSEE------GGGS-GGGCHHHSSS-SSEEEEEEE----------S-EEETT--------EEEEEECEEEEEEE-TTC
T ss_pred             ccceeecc----cCccChHHhhhhccCCCceEEEEEecccccCCcccccccccc--------eEEeecccccccccccce
Confidence            35677776    999999999942 33456999999999999999999998765        59999999999998 899


Q ss_pred             eeEEEEEEEEEeccCCCCCCCCCCeEEEEEEeC
Q 021353           82 QKGCRKIMVLYKSTKKGTKPDKSNWVMHQYHLG  114 (313)
Q Consensus        82 ~VG~KK~LvFY~g~~~g~kg~KT~WvMHEY~L~  114 (313)
                      +||+||+|+||.++  ++++.+|+|+||||+|.
T Consensus        99 ~iG~k~~l~f~~~~--~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   99 VIGFKKTLVFYSGK--SPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             EEEEEEEEEEEESS--TTS-EEEEEEEEEEEE-
T ss_pred             eeeeEEEEEEEecc--CCCCCcCCeEEEEEEeC
Confidence            99999999999876  56789999999999984


No 2  
>PF05865 Cypo_polyhedrin:  Cypovirus polyhedrin protein;  InterPro: IPR008464 This family consists of several Cypovirus polyhedrin proteins. Polyhedrin is known to form a crystalline matrix (polyhedra) in infected insect cells [].; PDB: 2OH7_A 2OH5_A 2OH6_A.
Probab=18.32  E-value=1.2e+02  Score=27.67  Aligned_cols=26  Identities=27%  Similarity=0.502  Sum_probs=17.2

Q ss_pred             eEeecC-CcceEEeCCeeeEEEEEEEE
Q 021353           66 RWHKTG-KTKPVIENGIQKGCRKIMVL   91 (313)
Q Consensus        66 ~Wk~tG-k~k~I~~~g~~VG~KK~LvF   91 (313)
                      -|.+|| +-+.|..+|.+||.-..|.+
T Consensus       142 pweatgikyrki~~dgeivgyshyfel  168 (248)
T PF05865_consen  142 PWEATGIKYRKIHRDGEIVGYSHYFEL  168 (248)
T ss_dssp             S-B--GGG-EEEEETTEEEEEEEEEE-
T ss_pred             CccccCceEEEeeccceEeeeeeeeec
Confidence            599999 56778889999999776653


No 3  
>PF10534 CRIC_ras_sig:  Connector enhancer of kinase suppressor of ras;  InterPro: IPR019555 The multi-domain protein Connector enhancer of kinase suppressor of ras (Connector enhancer of KSR) (CNK) functions as a scaffold in several signal cascades and acts on proliferation, differentiation and apoptosis. CNK connects upstream activators and downstream targets of Ras- and Rho-dependent signalling pathways and may allow cross-talk between these pathways. In invertebrates, CNK is expressed as one isoform, whereas in mammals there exists CNK1, CNK2A, and its splice variant CNK2B. CNK proteins consist of one sterile alpha motif (SAM) domain (see PDOC50105 from PROSITEDOC, IPR001660 from INTERPRO) one conserved region in CNK (CRIC) domain, one PSD-96/Dlg-A/ZO-1 (PDZ) domain (see PDOC50106 from PROSITEDOC, IPR001478 from INTERPRO) and one pleckstrin homology (PH) domain (see PDOC50003 from PROSITEDOC, IPR001849 from INTERPRO. The CRIC domain is enriched in leucine residues and functions as a protein-protein interaction domain [, ].; PDB: 1WWV_A.
Probab=12.64  E-value=69  Score=26.27  Aligned_cols=23  Identities=35%  Similarity=0.728  Sum_probs=0.0

Q ss_pred             CCCCccccceee--chhhHhhhhhc
Q 021353          290 TPPDSHLADLQF--SDESILGWLDR  312 (313)
Q Consensus       290 Tppdf~Ls~~~f--sq~s~~~~~~~  312 (313)
                      +|.+|.=+-++-  .-.++++||||
T Consensus        37 ~p~~vL~aVveLi~aAK~Ll~WLdR   61 (95)
T PF10534_consen   37 PPNDVLTAVVELIGAAKALLSWLDR   61 (95)
T ss_dssp             -------------------------
T ss_pred             CcHHHHHHHHHHHHHHHhhcccccC
Confidence            466776666666  78889999988


No 4  
>PF06214 SLAM:  Signaling lymphocytic activation molecule (SLAM) protein;  InterPro: IPR010407 This entry is found in several mammalian signalling lymphocytic activation molecule (SLAM) proteins. Optimal T cell activation and expansion require engagement of the TCR plus co-stimulatory signals delivered through accessory molecules. SLAM, a 70 kDa co-stimulatory molecule belonging to the Ig superfamily, is defined as a human cell surface molecule that mediates CD28-independent proliferation of human T cells and IFN-gamma production by human Th1 and Th2 clones []. SLAM has also been recognised as a receptor for Measles virus [].; GO: 0004872 receptor activity, 0046649 lymphocyte activation, 0009986 cell surface, 0016021 integral to membrane; PDB: 3ALX_D 3ALZ_B 3ALW_A.
Probab=10.58  E-value=1.2e+02  Score=26.06  Aligned_cols=27  Identities=22%  Similarity=0.234  Sum_probs=16.7

Q ss_pred             CCCCCCCCCCCC----CCCCCCCeEEEeeec
Q 021353           14 QGICYTHPENLP----GAKKDGSSVHFFHRT   40 (313)
Q Consensus        14 ~dIy~~~PwdLP----g~~~~G~~wYFFs~~   40 (313)
                      .|=|.+|+.+|.    +-++..+-|||-+-.
T Consensus        93 edgY~FhlEnLsL~Il~SrkE~EGWYfmtlE  123 (126)
T PF06214_consen   93 EDGYKFHLENLSLEILESRKEDEGWYFMTLE  123 (126)
T ss_dssp             SSSEEEETTTTEEEETT--GGG-EEEEEEEE
T ss_pred             ccccEEecccceeehhccccccCceEEEEee
Confidence            356889999984    333444678887653


No 5  
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=9.72  E-value=2.1e+02  Score=16.12  Aligned_cols=8  Identities=13%  Similarity=0.393  Sum_probs=6.2

Q ss_pred             CCeEEEee
Q 021353           31 GSSVHFFH   38 (313)
Q Consensus        31 G~~wYFFs   38 (313)
                      +..||||.
T Consensus         7 ~~~wYy~~   14 (19)
T PF01473_consen    7 NGNWYYFD   14 (19)
T ss_dssp             TTEEEEET
T ss_pred             CCEEEEeC
Confidence            46899994


No 6  
>PF07045 DUF1330:  Protein of unknown function (DUF1330);  InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.; PDB: 2FIU_B 3HHL_A 3DCA_D 3LO3_I.
Probab=9.27  E-value=2e+02  Score=21.15  Aligned_cols=17  Identities=24%  Similarity=0.536  Sum_probs=13.0

Q ss_pred             ccceee-chhhHhhhhhc
Q 021353          296 LADLQF-SDESILGWLDR  312 (313)
Q Consensus       296 Ls~~~f-sq~s~~~~~~~  312 (313)
                      +.=++| |.+.+.+|.++
T Consensus        41 ~viieFPs~~aa~~~~~s   58 (65)
T PF07045_consen   41 VVIIEFPSMEAAKAWYNS   58 (65)
T ss_dssp             EEEEEESSHHHHHHHHCS
T ss_pred             EEEEECCCHHHHHHHHCC
Confidence            445789 99999998753


No 7  
>PF12043 DUF3527:  Domain of unknown function (DUF3527);  InterPro: IPR021916  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is about 120 amino acids in length. This domain has a conserved CDCGGWD sequence motif. 
Probab=9.27  E-value=6.4e+02  Score=25.38  Aligned_cols=84  Identities=15%  Similarity=0.135  Sum_probs=43.1

Q ss_pred             ccccCCCCCCCCCCCCCCCCCCCC-eEEEe-eecccccccCCcccccccCCCCCCCCCceEeecC-CcceEEeCCeeeEE
Q 021353            9 TIEGDQGICYTHPENLPGAKKDGS-SVHFF-HRTTNAYATGQRKRRKIQSEHSLNEEHVRWHKTG-KTKPVIENGIQKGC   85 (313)
Q Consensus         9 tvd~d~dIy~~~PwdLPg~~~~G~-~wYFF-s~~~~ky~~G~R~~R~t~~G~~~~~~~G~Wk~tG-k~k~I~~~g~~VG~   85 (313)
                      -|+...+||..-.|.+--..+++- ..|=| +....|        |+          .|.|...+ +.|..   +.+||-
T Consensus        23 svd~~~~VlaAt~~k~~~~~~~~~~~vYTFhs~~e~K--------Kk----------s~~w~~~~~k~k~~---~~iVGQ   81 (346)
T PF12043_consen   23 SVDNPEEVLAATMWKSGSSDKNDLNWVYTFHSIKEVK--------KK----------SGSWINSGDKNKSS---SNIVGQ   81 (346)
T ss_pred             EeCCcccEEEEEEeecccccccccceEEEEEeecccc--------cc----------ccccccccccccCC---cceEEE
Confidence            456667889888888753333333 34644 433221        11          12455443 23322   268888


Q ss_pred             EEEEEEEeccCCCCCCCCCCeEEEEEEeCCCC
Q 021353           86 RKIMVLYKSTKKGTKPDKSNWVMHQYHLGTDE  117 (313)
Q Consensus        86 KK~LvFY~g~~~g~kg~KT~WvMHEY~L~~~~  117 (313)
                      .|.=..+....   ...+. =+..||.|-..+
T Consensus        82 MkVSss~~~~~---~~~~~-s~~~EFVLf~~~  109 (346)
T PF12043_consen   82 MKVSSSLSSEP---SKQGS-SMVTEFVLFGVD  109 (346)
T ss_pred             EEeeeeeeecc---cCCcc-eeEEEEEEEecc
Confidence            88765554442   11222 455677776654


No 8  
>TIGR03116 cas_csf3 CRISPR-associated protein, Csf3 family. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf3 (CRISPR/cas Subtype as in A. ferrooxidans protein 3), as it lies third closest to the repeats.
Probab=9.13  E-value=2.2e+02  Score=26.61  Aligned_cols=22  Identities=27%  Similarity=0.508  Sum_probs=16.3

Q ss_pred             cccccCCCCCCCCCceEeecCCcceE
Q 021353           51 RRKIQSEHSLNEEHVRWHKTGKTKPV   76 (313)
Q Consensus        51 ~R~t~~G~~~~~~~G~Wk~tGk~k~I   76 (313)
                      +|.++.+    ...|.|.+.|+.++-
T Consensus        94 ~r~i~d~----~~~g~~~a~g~~~p~  115 (214)
T TIGR03116        94 SRFIGDD----LDRGLWQARGKVNPE  115 (214)
T ss_pred             hhhhccc----hhhhhhhhcccCCCc
Confidence            4666554    678899999988763


No 9  
>PRK10154 hypothetical protein; Provisional
Probab=8.48  E-value=3.5e+02  Score=23.58  Aligned_cols=21  Identities=5%  Similarity=0.268  Sum_probs=15.4

Q ss_pred             EEEEEEEeccCCCCCCCCCCeEEE
Q 021353           86 RKIMVLYKSTKKGTKPDKSNWVMH  109 (313)
Q Consensus        86 KK~LvFY~g~~~g~kg~KT~WvMH  109 (313)
                      .++|.||+.=   .++..|+|+--
T Consensus        80 s~tl~f~~~l---k~~q~T~W~~~  100 (134)
T PRK10154         80 SQSLNIPSEI---KEGQTTDWINI  100 (134)
T ss_pred             ceEEecchhh---ccCCccccEEc
Confidence            3788888765   45689999853


No 10 
>KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton]
Probab=7.97  E-value=89  Score=34.62  Aligned_cols=50  Identities=20%  Similarity=0.313  Sum_probs=35.2

Q ss_pred             eeeEEEEE-E----------EEEeccCCCCCCCCCCeEEEEEEeCCCCCCCCCCe--EEEEEEEe
Q 021353           81 IQKGCRKI-M----------VLYKSTKKGTKPDKSNWVMHQYHLGTDEDEKDDEY--VVSKVFYQ  132 (313)
Q Consensus        81 ~~VG~KK~-L----------vFY~g~~~g~kg~KT~WvMHEY~L~~~~~~~~~e~--VLCKIf~k  132 (313)
                      .+||+|-. |          .|+.|+  ..++.|++.-|.||...+...+...+|  |||--|+.
T Consensus       613 pIvG~RyR~l~~fn~dlCq~CF~sgr--aak~hk~~~pM~Ey~~~tts~~d~rdfak~L~nkfr~  675 (966)
T KOG4286|consen  613 PIIGFRYRSLKHFNYDICQSCFFSGR--AAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRT  675 (966)
T ss_pred             ccceeeeeehhhcChhHHhhHhhhcc--cccCCCCCCCceeeeCCCCChhhHHHHHHHHHhhhcc
Confidence            47787743 3          366777  567899999999999999875543444  56665554


Done!