BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021385
         (313 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2QLV|A Chain A, Crystal Structure Of The Heterotrimer Core Of The S.
           Cerevisiae Ampk Homolog Snf1
 pdb|2QLV|D Chain D, Crystal Structure Of The Heterotrimer Core Of The S.
           Cerevisiae Ampk Homolog Snf1
          Length = 171

 Score = 33.1 bits (74), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 253 VRWKYDLGRKKNFEQVYPVQLHLWLQELQNEQRRFLVQTRHYG 295
           +RWKYD+G K N  +  P  + + +Q  Q E   +LV  +  G
Sbjct: 87  LRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDG 129


>pdb|3T4N|A Chain A, Structure Of The Regulatory Fragment Of Saccharomyces
           Cerevisiae Ampk In Complex With Adp
 pdb|3TDH|A Chain A, Structure Of The Regulatory Fragment Of Sccharomyces
           Cerevisiae Ampk In Complex With Amp
 pdb|3TE5|A Chain A, Structure Of The Regulatory Fragment Of Sacchromyces
           Cerevisiae Ampk In Complex With Nadh
          Length = 179

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 253 VRWKYDLGRKKNFEQVYPVQLHLWLQELQNEQRRFLVQTRHYG 295
           +RWKYD+G K N  +  P  + + +Q  Q E   +LV  +  G
Sbjct: 92  LRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDG 134


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.140    0.459 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,972,318
Number of Sequences: 62578
Number of extensions: 259000
Number of successful extensions: 625
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 621
Number of HSP's gapped (non-prelim): 4
length of query: 313
length of database: 14,973,337
effective HSP length: 99
effective length of query: 214
effective length of database: 8,778,115
effective search space: 1878516610
effective search space used: 1878516610
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)