BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 021385
(313 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2QLV|A Chain A, Crystal Structure Of The Heterotrimer Core Of The S.
Cerevisiae Ampk Homolog Snf1
pdb|2QLV|D Chain D, Crystal Structure Of The Heterotrimer Core Of The S.
Cerevisiae Ampk Homolog Snf1
Length = 171
Score = 33.1 bits (74), Expect = 0.18, Method: Compositional matrix adjust.
Identities = 15/43 (34%), Positives = 23/43 (53%)
Query: 253 VRWKYDLGRKKNFEQVYPVQLHLWLQELQNEQRRFLVQTRHYG 295
+RWKYD+G K N + P + + +Q Q E +LV + G
Sbjct: 87 LRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDG 129
>pdb|3T4N|A Chain A, Structure Of The Regulatory Fragment Of Saccharomyces
Cerevisiae Ampk In Complex With Adp
pdb|3TDH|A Chain A, Structure Of The Regulatory Fragment Of Sccharomyces
Cerevisiae Ampk In Complex With Amp
pdb|3TE5|A Chain A, Structure Of The Regulatory Fragment Of Sacchromyces
Cerevisiae Ampk In Complex With Nadh
Length = 179
Score = 33.1 bits (74), Expect = 0.20, Method: Compositional matrix adjust.
Identities = 15/43 (34%), Positives = 23/43 (53%)
Query: 253 VRWKYDLGRKKNFEQVYPVQLHLWLQELQNEQRRFLVQTRHYG 295
+RWKYD+G K N + P + + +Q Q E +LV + G
Sbjct: 92 LRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDG 134
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.140 0.459
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,972,318
Number of Sequences: 62578
Number of extensions: 259000
Number of successful extensions: 625
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 621
Number of HSP's gapped (non-prelim): 4
length of query: 313
length of database: 14,973,337
effective HSP length: 99
effective length of query: 214
effective length of database: 8,778,115
effective search space: 1878516610
effective search space used: 1878516610
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)