Citrus Sinensis ID: 021393
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| 255567758 | 313 | catalytic, putative [Ricinus communis] g | 1.0 | 1.0 | 0.811 | 1e-152 | |
| 224127222 | 308 | predicted protein [Populus trichocarpa] | 0.980 | 0.996 | 0.785 | 1e-142 | |
| 225434150 | 314 | PREDICTED: uncharacterized hydrolase yut | 1.0 | 0.996 | 0.786 | 1e-138 | |
| 449452883 | 313 | PREDICTED: uncharacterized hydrolase Yut | 0.984 | 0.984 | 0.795 | 1e-137 | |
| 357475623 | 312 | hypothetical protein MTR_4g087590 [Medic | 0.996 | 1.0 | 0.773 | 1e-136 | |
| 356521455 | 315 | PREDICTED: uncharacterized hydrolase yut | 1.0 | 0.993 | 0.758 | 1e-132 | |
| 356500114 | 315 | PREDICTED: uncharacterized hydrolase yut | 1.0 | 0.993 | 0.755 | 1e-132 | |
| 297807077 | 306 | hypothetical protein ARALYDRAFT_909002 [ | 0.971 | 0.993 | 0.715 | 1e-130 | |
| 19310550 | 316 | unknown protein [Arabidopsis thaliana] | 0.971 | 0.962 | 0.702 | 1e-127 | |
| 42567769 | 306 | haloacid dehalogenase-like hydrolase dom | 0.971 | 0.993 | 0.702 | 1e-127 |
| >gi|255567758|ref|XP_002524857.1| catalytic, putative [Ricinus communis] gi|223535820|gb|EEF37481.1| catalytic, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 542 bits (1396), Expect = e-152, Method: Compositional matrix adjust.
Identities = 254/313 (81%), Positives = 287/313 (91%)
Query: 1 MIAKCSVQSNDPHLFQTLNGLRHIAETRRFKAWLLDQFGVLHDGKKPYPGAISTLEMLAT 60
M+ + S++ N+ HLFQT NGL+H+AETRRFKAWLLDQFGVLHDGK+PYPGAISTL+ +A+
Sbjct: 1 MMPQSSIKYNEAHLFQTFNGLQHLAETRRFKAWLLDQFGVLHDGKQPYPGAISTLKKIAS 60
Query: 61 TGAKMVVISNSSRRASTTIDKLKSLGFDPSLFAGAITSGELTHQYLLRRDDAWFAALGRS 120
+GAKMV+ISNSSRRASTT+DK+KSLGFDPSLF GAITSGELTHQ+L RRDD WFAALG+S
Sbjct: 61 SGAKMVIISNSSRRASTTMDKMKSLGFDPSLFVGAITSGELTHQFLQRRDDDWFAALGKS 120
Query: 121 CIHMTWSDRGAISLEGLGLKVVENVEEADFILAHGTEGMGLPSGDVRPMSLQDLEKILEI 180
CIHMTWSDRGAISLEGLGL+VVENVEEA F+LAHGTE +G PSG PM+L++LEKILE
Sbjct: 121 CIHMTWSDRGAISLEGLGLQVVENVEEAAFVLAHGTEALGQPSGAACPMTLEELEKILEH 180
Query: 181 CASKKIPMVVANPDYVTVEARALRVMPGTLASKFEKLGGEVRWMGKPDKIIYKSAMAMVG 240
CA+K IPMVVANPD+VTVEAR LRVMPGTLA+K+EKLGGEV+WMGKPDKIIYKSAM M G
Sbjct: 181 CAAKGIPMVVANPDFVTVEARNLRVMPGTLAAKYEKLGGEVKWMGKPDKIIYKSAMVMAG 240
Query: 241 VDACDSIAVGDSLHHDIKGANAAGIQSVFIIGGIHATELGLDSYGEVADLSSVQTLVSKY 300
VDA DSIAVGDSLHHDIKGANAAGIQS FI GGIHA+ELGL S+GE+ADLSSVQ L SKY
Sbjct: 241 VDALDSIAVGDSLHHDIKGANAAGIQSAFITGGIHASELGLGSFGEIADLSSVQALASKY 300
Query: 301 DAYPSYVLPSFSW 313
DA+PSYVLPSF+W
Sbjct: 301 DAHPSYVLPSFTW 313
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224127222|ref|XP_002329430.1| predicted protein [Populus trichocarpa] gi|222870480|gb|EEF07611.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225434150|ref|XP_002278008.1| PREDICTED: uncharacterized hydrolase yutF [Vitis vinifera] gi|296084318|emb|CBI24706.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449452883|ref|XP_004144188.1| PREDICTED: uncharacterized hydrolase YutF-like [Cucumis sativus] gi|449511400|ref|XP_004163945.1| PREDICTED: uncharacterized hydrolase YutF-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357475623|ref|XP_003608097.1| hypothetical protein MTR_4g087590 [Medicago truncatula] gi|355509152|gb|AES90294.1| hypothetical protein MTR_4g087590 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356521455|ref|XP_003529371.1| PREDICTED: uncharacterized hydrolase yutF-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356500114|ref|XP_003518879.1| PREDICTED: uncharacterized hydrolase yutF-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297807077|ref|XP_002871422.1| hypothetical protein ARALYDRAFT_909002 [Arabidopsis lyrata subsp. lyrata] gi|297317259|gb|EFH47681.1| hypothetical protein ARALYDRAFT_909002 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|19310550|gb|AAL85008.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42567769|ref|NP_196608.2| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|50198963|gb|AAT70484.1| At5g10460 [Arabidopsis thaliana] gi|332004162|gb|AED91545.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| TAIR|locus:2142454 | 306 | AT5G10460 "AT5G10460" [Arabido | 0.958 | 0.980 | 0.713 | 4.4e-116 | |
| TIGR_CMR|SPO_3151 | 310 | SPO_3151 "HAD-superfamily subf | 0.932 | 0.941 | 0.266 | 4.8e-23 | |
| UNIPROTKB|F1MW60 | 296 | PDXP "Pyridoxal phosphate phos | 0.757 | 0.800 | 0.268 | 8.4e-08 | |
| UNIPROTKB|Q3ZBF9 | 296 | PDXP "Pyridoxal phosphate phos | 0.757 | 0.800 | 0.268 | 8.4e-08 | |
| UNIPROTKB|Q81XP1 | 254 | BAS4827 "Phosphatase,haloacid | 0.383 | 0.472 | 0.264 | 2.8e-07 | |
| TIGR_CMR|BA_5192 | 254 | BA_5192 "phosphatase,haloacid | 0.383 | 0.472 | 0.264 | 2.8e-07 | |
| UNIPROTKB|J9NUR4 | 296 | PDXP "Uncharacterized protein" | 0.757 | 0.800 | 0.275 | 4.2e-07 | |
| UNIPROTKB|Q96GD0 | 296 | PDXP "Pyridoxal phosphate phos | 0.757 | 0.800 | 0.256 | 5.5e-07 | |
| POMBASE|SPBC15D4.15 | 298 | pho2 "4-nitrophenylphosphatase | 0.840 | 0.882 | 0.235 | 7.2e-07 | |
| RGD|1586212 | 309 | Pdxp "pyridoxal (pyridoxine, v | 0.252 | 0.255 | 0.357 | 1.1e-06 |
| TAIR|locus:2142454 AT5G10460 "AT5G10460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1144 (407.8 bits), Expect = 4.4e-116, P = 4.4e-116
Identities = 214/300 (71%), Positives = 255/300 (85%)
Query: 14 LFQTLNGLRHIAETRRFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNSSR 73
L Q +NGL+ I ETR FKAWLLDQ+GVLHDGKKPYPGAISTL+ LAT GAK+V+ISNSSR
Sbjct: 7 LSQPMNGLKDIVETRNFKAWLLDQYGVLHDGKKPYPGAISTLKNLATAGAKIVIISNSSR 66
Query: 74 RASTTIDKLKSLGFDPSLFAGAITSGELTHQYLLRRDDAWFAALGRSCIHMTWSDRGAIS 133
RASTT++KLK LGFDPS F GAITSGELTHQ L RRDD WFAALGR CIH+TW+DRGAIS
Sbjct: 67 RASTTMEKLKGLGFDPSFFTGAITSGELTHQSLQRRDDPWFAALGRRCIHITWNDRGAIS 126
Query: 134 LEGLGLKVVENVEEADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKKIPMVVANP 193
LEGL L VVENVEEADF+LAHGTE +GLPSG V P ++ +LEKILE A++ +PM+VANP
Sbjct: 127 LEGLDLNVVENVEEADFVLAHGTEALGLPSGSVSPRTIDELEKILEKSAARGLPMIVANP 186
Query: 194 DYVTVEARALRVMPGTLASKFEKLGGEVRWMGKPDKIIYKSAMAMVGVDACDSIAVGDSL 253
DYVTVEA +MPGTLASK+E+LGGEV+ MGKP K+IY+SA+A+ GV+ +SIAVGDSL
Sbjct: 187 DYVTVEANVFHIMPGTLASKYEELGGEVKSMGKPHKMIYESAIAIAGVNPSESIAVGDSL 246
Query: 254 HHDIKGANAAGIQSVFIIGGIHATELGLDSYGEVADLSSVQTLVSKYDAYPSYVLPSFSW 313
HHDI+GAN +GI+S+FI GGIH ELGL S+ E A L SV+TL +K++A+P+YVL +F W
Sbjct: 247 HHDIRGANVSGIESIFITGGIHGNELGLTSFDETASLDSVKTLTAKHNAFPTYVLSAFKW 306
|
|
| TIGR_CMR|SPO_3151 SPO_3151 "HAD-superfamily subfamily IIA hydrolase, TIGR01459" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MW60 PDXP "Pyridoxal phosphate phosphatase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBF9 PDXP "Pyridoxal phosphate phosphatase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q81XP1 BAS4827 "Phosphatase,haloacid dehalogenase family" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5192 BA_5192 "phosphatase,haloacid dehalogenase family" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NUR4 PDXP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96GD0 PDXP "Pyridoxal phosphate phosphatase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC15D4.15 pho2 "4-nitrophenylphosphatase" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| RGD|1586212 Pdxp "pyridoxal (pyridoxine, vitamin B6) phosphatase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_scaffold_120000092 | hypothetical protein (308 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.IX.1599.1 | • | 0.652 | |||||||||
| eugene3.01370007 | • | 0.465 | |||||||||
| gw1.X.1500.1 | • | 0.461 | |||||||||
| estExt_fgenesh4_pg.C_LG_VIII0664 | • | 0.435 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| TIGR01459 | 242 | TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class | 9e-45 | |
| COG0647 | 269 | COG0647, NagD, Predicted sugar phosphatases of the | 6e-39 | |
| TIGR01460 | 236 | TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Super | 2e-24 | |
| pfam13344 | 101 | pfam13344, Hydrolase_6, Haloacid dehalogenase-like | 1e-16 | |
| pfam13242 | 74 | pfam13242, Hydrolase_like, HAD-hyrolase-like | 3e-11 | |
| TIGR01452 | 279 | TIGR01452, PGP_euk, phosphoglycolate/pyridoxal pho | 1e-09 | |
| TIGR01457 | 249 | TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfam | 2e-08 | |
| COG1011 | 229 | COG1011, COG1011, Predicted hydrolase (HAD superfa | 2e-08 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 1e-07 | |
| TIGR01458 | 257 | TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfam | 4e-06 | |
| TIGR02253 | 221 | TIGR02253, CTE7, HAD superfamily (subfamily IA) hy | 7e-06 | |
| pfam13419 | 176 | pfam13419, HAD_2, Haloacid dehalogenase-like hydro | 1e-05 | |
| TIGR02252 | 203 | TIGR02252, DREG-2, REG-2-like, HAD superfamily (su | 5e-05 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 6e-05 | |
| TIGR02253 | 221 | TIGR02253, CTE7, HAD superfamily (subfamily IA) hy | 9e-05 | |
| pfam00702 | 187 | pfam00702, Hydrolase, haloacid dehalogenase-like h | 9e-05 | |
| PRK09449 | 224 | PRK09449, PRK09449, dUMP phosphatase; Provisional | 1e-04 | |
| COG0546 | 220 | COG0546, Gph, Predicted phosphatases [General func | 2e-04 | |
| TIGR01509 | 177 | TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase sup | 7e-04 | |
| PRK10444 | 248 | PRK10444, PRK10444, UMP phosphatase; Provisional | 9e-04 | |
| TIGR02254 | 224 | TIGR02254, YjjG/YfnB, HAD superfamily (subfamily I | 0.002 | |
| PLN02645 | 311 | PLN02645, PLN02645, phosphoglycolate phosphatase | 0.003 | |
| COG0637 | 221 | COG0637, COG0637, Predicted phosphatase/phosphohex | 0.003 | |
| COG0637 | 221 | COG0637, COG0637, Predicted phosphatase/phosphohex | 0.004 |
| >gnl|CDD|130526 TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
Score = 152 bits (385), Expect = 9e-45
Identities = 69/246 (28%), Positives = 109/246 (44%), Gaps = 12/246 (4%)
Query: 29 RFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNSSRRASTTIDKLKSLGFD 88
+ +LLD +GV+ DG YPGA+ L + G + +SNS R + LKSLG +
Sbjct: 7 DYDVFLLDLWGVIIDGNHTYPGAVQNLNKIIAQGKPVYFVSNSPRNIFSLHKTLKSLGIN 66
Query: 89 PSLFAGAITSGELTHQYLLRRDDAWFAALGRSCI-HMTWSDRGAISLEGLGLKVVENVEE 147
L I+SGE+ Q +L + + I + + I+L EN
Sbjct: 67 ADLPEMIISSGEIAVQMIL--ESKKRFDIRNGIIYLLGHLENDIINLMQCYTTDDENKAN 124
Query: 148 ADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKKIPMVVANPDYVTVEARALRVMP 207
A I + +E L L + +++ ++KIP + ANPD + R
Sbjct: 125 ASLITIYRSENEKLD--------LDEFDELFAPIVARKIPNICANPDRGINQHGIYRYGA 176
Query: 208 GTLASKFEKLGGEVRWMGKPDKIIYKSAMAMVGVDACDSIA-VGDSLHHDIKGANAAGIQ 266
G A ++LGG+V + GKP I+ A+ + + VGDS + DI GAN GI
Sbjct: 177 GYYAELIKQLGGKVIYSGKPYPAIFHKALKECSNIPKNRMLMVGDSFYTDILGANRLGID 236
Query: 267 SVFIIG 272
+ ++
Sbjct: 237 TALVLT 242
|
This hypothetical equivalog is a member of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases. The sequences modelled by this equivalog are all gram negative and primarily alpha proteobacteria. Only one sequence hase been annotated as other than "hypothetical." That one, from Brucella, is annotated as related to NagD, but only by sequence similarity and should be treated with some skepticism. (See comments for Class IIA subfamily model). Length = 242 |
| >gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233422 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >gnl|CDD|205524 pfam13344, Hydrolase_6, Haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like | Back alignment and domain information |
|---|
| >gnl|CDD|233420 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >gnl|CDD|130524 TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|162372 TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|200170 TIGR02252, DREG-2, REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|181865 PRK09449, PRK09449, dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233443 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >gnl|CDD|182466 PRK10444, PRK10444, UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162788 TIGR02254, YjjG/YfnB, HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >gnl|CDD|178251 PLN02645, PLN02645, phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 100.0 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 100.0 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 100.0 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 100.0 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 100.0 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 100.0 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 100.0 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 100.0 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 100.0 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 100.0 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 100.0 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 99.82 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 99.81 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 99.81 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 99.8 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 99.8 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 99.8 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 99.79 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 99.79 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 99.79 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 99.79 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 99.78 | |
| KOG1618 | 389 | consensus Predicted phosphatase [General function | 99.77 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 99.77 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 99.77 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 99.76 | |
| PRK06769 | 173 | hypothetical protein; Validated | 99.76 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 99.76 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 99.75 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 99.75 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 99.74 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 99.74 | |
| PLN02940 | 382 | riboflavin kinase | 99.74 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 99.73 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 99.73 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 99.73 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.72 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 99.72 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 99.72 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 99.71 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 99.71 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 99.7 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 99.7 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 99.7 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 99.7 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 99.7 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 99.69 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 99.69 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 99.68 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 99.68 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 99.68 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 99.66 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 99.66 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 99.65 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.65 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 99.65 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 99.63 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 99.63 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 99.61 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 99.61 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 99.6 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 99.58 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 99.57 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 99.57 | |
| PLN02811 | 220 | hydrolase | 99.56 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 99.56 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 99.56 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 99.55 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 99.54 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.53 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 99.53 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.52 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 99.51 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 99.49 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 99.48 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 99.48 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 99.47 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 99.47 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 99.46 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.46 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 99.45 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.44 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 99.43 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 99.43 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 99.42 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 99.4 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 99.4 | |
| PLN02887 | 580 | hydrolase family protein | 99.4 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.38 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.37 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 99.37 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 99.37 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 99.37 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.36 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.36 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.35 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 99.35 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 99.32 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 99.32 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 99.28 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.25 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.22 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 99.2 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 99.19 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 99.18 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 99.15 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.15 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 99.14 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 99.12 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.1 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 99.05 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 99.03 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 99.03 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 99.02 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.0 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 98.91 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 98.89 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 98.82 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 98.81 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 98.81 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 98.77 | |
| PLN02423 | 245 | phosphomannomutase | 98.75 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 98.73 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.71 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 98.68 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 98.59 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 98.53 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 98.42 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.42 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 98.39 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 98.35 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 98.32 | |
| COG4229 | 229 | Predicted enolase-phosphatase [Energy production a | 98.27 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.24 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 98.2 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.15 | |
| PRK08238 | 479 | hypothetical protein; Validated | 98.11 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 98.1 | |
| PLN02580 | 384 | trehalose-phosphatase | 98.06 | |
| PLN03017 | 366 | trehalose-phosphatase | 98.04 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 97.97 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 97.89 | |
| KOG2961 | 190 | consensus Predicted hydrolase (HAD superfamily) [G | 97.86 | |
| PLN02151 | 354 | trehalose-phosphatase | 97.78 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 97.76 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 97.72 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 97.69 | |
| PF06437 | 408 | ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 | 97.59 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 97.44 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 97.4 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 97.37 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 97.34 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 97.21 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 97.13 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 97.08 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 97.07 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 97.02 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 96.97 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 96.93 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 96.75 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 96.72 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 96.65 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 96.56 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 96.4 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 96.32 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 96.24 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 95.99 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 95.98 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 95.96 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 95.83 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 95.38 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 95.33 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 95.24 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 95.11 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 94.94 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 94.89 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 94.87 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 94.77 | |
| PF05761 | 448 | 5_nucleotid: 5' nucleotidase family; InterPro: IPR | 94.45 | |
| TIGR01658 | 274 | EYA-cons_domain eyes absent protein conserved doma | 93.69 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 93.5 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 93.47 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 92.85 | |
| COG5610 | 635 | Predicted hydrolase (HAD superfamily) [General fun | 92.34 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 92.31 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 92.29 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 91.8 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 91.77 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 91.36 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 90.62 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 90.57 | |
| COG4850 | 373 | Uncharacterized conserved protein [Function unknow | 90.32 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 90.32 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 90.23 | |
| KOG3189 | 252 | consensus Phosphomannomutase [Lipid transport and | 90.2 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 90.16 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 90.02 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 89.92 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 89.84 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 89.8 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 89.47 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 89.44 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 89.39 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 89.09 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 89.08 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 88.96 | |
| PF04312 | 138 | DUF460: Protein of unknown function (DUF460); Inte | 88.77 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 88.46 | |
| KOG2961 | 190 | consensus Predicted hydrolase (HAD superfamily) [G | 88.26 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 88.16 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 88.13 | |
| KOG2116 | 738 | consensus Protein involved in plasmid maintenance/ | 88.1 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 88.04 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 87.99 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 87.66 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 87.66 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 87.5 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 87.23 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 86.95 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 86.76 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 86.5 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 86.35 | |
| KOG2630 | 254 | consensus Enolase-phosphatase E-1 [Amino acid tran | 86.34 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 85.63 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 85.48 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 85.28 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 84.84 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 84.58 | |
| KOG2470 | 510 | consensus Similar to IMP-GMP specific 5'-nucleotid | 84.52 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 84.49 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 84.34 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 84.08 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 83.16 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 82.75 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 81.95 | |
| COG5083 | 580 | SMP2 Uncharacterized protein involved in plasmid m | 81.9 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 81.44 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 81.28 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 80.75 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 80.62 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 80.58 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 80.23 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 80.08 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 80.05 |
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-44 Score=318.05 Aligned_cols=253 Identities=29% Similarity=0.519 Sum_probs=220.4
Q ss_pred HHhhhhcCccEEEEeccceeecCCccCccHHHHHHHHHHCCCcEEEEeCCCCCc-hHHHHHHHh-CCCCCcccccccchH
Q 021393 22 RHIAETRRFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNSSRRA-STTIDKLKS-LGFDPSLFAGAITSG 99 (313)
Q Consensus 22 ~~~~~~~~~k~iifDlDGTL~~~~~~~~~a~~~l~~l~~~g~~~~~~Tn~~~~~-~~~~~~l~~-~G~~~~~~~~ii~~~ 99 (313)
.++++ +|++++||+||||+++.+++|++.++|++|+++|++++++||+++.. +.+.++|++ +|++... +.|++|+
T Consensus 2 ~~~~~--~y~~~l~DlDGvl~~G~~~ipga~e~l~~L~~~g~~~iflTNn~~~s~~~~~~~L~~~~~~~~~~-~~i~TS~ 78 (269)
T COG0647 2 FDVMD--KYDGFLFDLDGVLYRGNEAIPGAAEALKRLKAAGKPVIFLTNNSTRSREVVAARLSSLGGVDVTP-DDIVTSG 78 (269)
T ss_pred cchhh--hcCEEEEcCcCceEeCCccCchHHHHHHHHHHcCCeEEEEeCCCCCCHHHHHHHHHhhcCCCCCH-HHeecHH
Confidence 34566 99999999999999999999999999999999999999999988665 559999999 5555655 9999999
Q ss_pred HHHHHHHHhcCchhhhhcCCeEEEeecCcccchhhccCCccccCCCCC--CCEEEecCCCCCCCCCCCCCCCCHHHHHHH
Q 021393 100 ELTHQYLLRRDDAWFAALGRSCIHMTWSDRGAISLEGLGLKVVENVEE--ADFILAHGTEGMGLPSGDVRPMSLQDLEKI 177 (313)
Q Consensus 100 ~~~~~~l~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~g~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 177 (313)
.++++|+.++.+ +++||+++.. .....+...|+.+..+.+. ++++++ |.|...+|+.+.++
T Consensus 79 ~at~~~l~~~~~------~~kv~viG~~-~l~~~l~~~G~~~~~~~~~~~~d~Vv~----------g~d~~~~~e~l~~a 141 (269)
T COG0647 79 DATADYLAKQKP------GKKVYVIGEE-GLKEELEGAGFELVDEEEPARVDAVVV----------GLDRTLTYEKLAEA 141 (269)
T ss_pred HHHHHHHHhhCC------CCEEEEECCc-chHHHHHhCCcEEeccCCCCcccEEEE----------ecCCCCCHHHHHHH
Confidence 999999999874 5788887643 3356899999988774444 366666 67899999999999
Q ss_pred HHHHHhCCCcEEEEcCCccccccchhccCCchHHHHHHHh-cCceeecCCCCHHHHHHHHHHhCCCCCcEEEEcCCchhh
Q 021393 178 LEICASKKIPMVVANPDYVTVEARALRVMPGTLASKFEKL-GGEVRWMGKPDKIIYKSAMAMVGVDACDSIAVGDSLHHD 256 (313)
Q Consensus 178 l~~l~~~g~~~i~tn~d~~~~~~~~~~~~~g~~~~~~~~~-~~~~~~~gKP~~~~~~~~~~~lgv~~~~~v~IGDs~~~D 256 (313)
+..+ ++|.+||+||+|..++.+.++.++.|.++.+++.+ +..+..+|||++.+|+.+++.++.++++|+||||++.+|
T Consensus 142 ~~~i-~~g~~fI~tNpD~~~p~~~g~~pgaGai~~~~~~~tg~~~~~~GKP~~~i~~~al~~~~~~~~~~~mVGD~~~TD 220 (269)
T COG0647 142 LLAI-AAGAPFIATNPDLTVPTERGLRPGAGAIAALLEQATGREPTVIGKPSPAIYEAALEKLGLDRSEVLMVGDRLDTD 220 (269)
T ss_pred HHHH-HcCCcEEEeCCCccccCCCCCccCcHHHHHHHHHhhCCcccccCCCCHHHHHHHHHHhCCCcccEEEEcCCchhh
Confidence 9765 56699999999999999999999999999999986 666779999999999999999999999999999999999
Q ss_pred HHHHHHcCCcEEEEcCCCCCCcccccCCCCccchhhHHHHHhhcCCCCcEEecCCc
Q 021393 257 IKGANAAGIQSVFIIGGIHATELGLDSYGEVADLSSVQTLVSKYDAYPSYVLPSFS 312 (313)
Q Consensus 257 i~~a~~aG~~~i~V~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~l~ 312 (313)
|.+|+++|+++++|+||.++.+++ .....+|+|+.+||+
T Consensus 221 I~~a~~~G~~t~LV~TGv~~~~~~-----------------~~~~~~p~~v~~sl~ 259 (269)
T COG0647 221 ILGAKAAGLDTLLVLTGVSSAEDL-----------------DRAEVKPTYVVDSLA 259 (269)
T ss_pred HHHHHHcCCCEEEEccCCCChhhh-----------------hhhccCCcchHhhHH
Confidence 999999999999999999988873 333679999999987
|
|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >KOG1618 consensus Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >COG4229 Predicted enolase-phosphatase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 | Back alignment and domain information |
|---|
| >TIGR01658 EYA-cons_domain eyes absent protein conserved domain | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >COG4850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF04312 DUF460: Protein of unknown function (DUF460); InterPro: IPR007408 This is an archaeal protein of unknown function | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 313 | ||||
| 2hx1_A | 284 | Crystal Structure Of Possible Sugar Phosphatase, Ha | 8e-11 | ||
| 3qgm_A | 268 | P-Nitrophenyl Phosphatase From Archaeoglobus Fulgid | 5e-10 | ||
| 3pdw_A | 266 | Crystal Structure Of Putative P-Nitrophenyl Phospha | 3e-09 | ||
| 2cfs_A | 298 | Crystal Structure Of Human Pyridoxal 5'-Phosphate P | 4e-08 | ||
| 2cfr_A | 298 | Crystal Structure Of Human Pyridoxal 5'-Phosphate P | 1e-07 | ||
| 2oyc_A | 306 | Crystal Structure Of Human Pyridoxal Phosphate Phos | 1e-07 | ||
| 1pw5_A | 253 | Putative Nagd Protein Length = 253 | 6e-07 | ||
| 1vjr_A | 271 | Crystal Structure Of 4-nitrophenylphosphatase (tm17 | 7e-07 | ||
| 1yv9_A | 264 | Crystal Structure Of A Had-Like Phosphatase From En | 2e-05 | ||
| 2c4n_A | 250 | Nagd From E.Coli K-12 Strain Length = 250 | 5e-05 | ||
| 3ib6_A | 189 | Crystal Structure Of An Uncharacterized Protein Fro | 2e-04 | ||
| 2hoq_A | 241 | Crystal Structure Of The Probable Haloacid Dehaloge | 5e-04 | ||
| 1ys9_A | 254 | Crystal Sructure Of Phosphatase Spy1043 From Strept | 5e-04 |
| >pdb|2HX1|A Chain A, Crystal Structure Of Possible Sugar Phosphatase, Had Superfamily (Zp_00311070.1) From Cytophaga Hutchinsonii Atcc 33406 At 2.10 A Resolution Length = 284 | Back alignment and structure |
|
| >pdb|3QGM|A Chain A, P-Nitrophenyl Phosphatase From Archaeoglobus Fulgidus Length = 268 | Back alignment and structure |
| >pdb|3PDW|A Chain A, Crystal Structure Of Putative P-Nitrophenyl Phosphatase From Bacillus Subtilis Length = 266 | Back alignment and structure |
| >pdb|2CFS|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 | Back alignment and structure |
| >pdb|2CFR|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 | Back alignment and structure |
| >pdb|2OYC|A Chain A, Crystal Structure Of Human Pyridoxal Phosphate Phosphatase Length = 306 | Back alignment and structure |
| >pdb|1PW5|A Chain A, Putative Nagd Protein Length = 253 | Back alignment and structure |
| >pdb|1VJR|A Chain A, Crystal Structure Of 4-nitrophenylphosphatase (tm1742) From Thermotoga Maritima At 2.40 A Resolution Length = 271 | Back alignment and structure |
| >pdb|1YV9|A Chain A, Crystal Structure Of A Had-Like Phosphatase From Enterococcus Faecalis V583 Length = 264 | Back alignment and structure |
| >pdb|2C4N|A Chain A, Nagd From E.Coli K-12 Strain Length = 250 | Back alignment and structure |
| >pdb|3IB6|A Chain A, Crystal Structure Of An Uncharacterized Protein From Listeria Monocytogenes Serotype 4b Length = 189 | Back alignment and structure |
| >pdb|2HOQ|A Chain A, Crystal Structure Of The Probable Haloacid Dehalogenase (Ph1655) From Pyrococcus Horikoshii Ot3 Length = 241 | Back alignment and structure |
| >pdb|1YS9|A Chain A, Crystal Sructure Of Phosphatase Spy1043 From Streptococcus Pyogenes Length = 254 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 4e-29 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 4e-23 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 2e-22 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 5e-21 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 7e-21 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 2e-19 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 9e-19 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 2e-18 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 3e-18 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 2e-17 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 2e-16 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 1e-15 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 7e-12 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 8e-06 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 1e-11 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 5e-06 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 2e-11 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 4e-11 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 4e-11 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 2e-06 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 5e-11 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 5e-04 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 5e-11 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 5e-05 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 3e-10 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 7e-10 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 5e-09 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 5e-06 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 2e-08 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 3e-07 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 2e-05 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 4e-07 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 2e-06 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 1e-05 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 2e-05 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 7e-04 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 2e-05 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 2e-05 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 3e-05 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 3e-05 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 3e-05 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 4e-05 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 5e-05 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 7e-05 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 3e-04 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 7e-05 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 3e-04 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 7e-05 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 7e-04 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 8e-05 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 1e-04 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 1e-04 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 2e-04 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 2e-04 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 2e-04 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 2e-04 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 2e-04 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 5e-04 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 2e-04 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 4e-04 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 7e-04 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 7e-04 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 8e-04 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 9e-04 |
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 | Back alignment and structure |
|---|
Score = 111 bits (280), Expect = 4e-29
Identities = 67/303 (22%), Positives = 116/303 (38%), Gaps = 33/303 (10%)
Query: 17 TLNGLRHIAETRRFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISN-SSRRA 75
+ + + ++K D FGVL PG +T + L G +++N +SR
Sbjct: 3 QIESFKSLLP--KYKCIFFDAFGVLKTYNGLLPGIENTFDYLKAQGQDYYIVTNDASRSP 60
Query: 76 STTIDKLKSLGFDPSLFAGAITSGELTHQYL-LRRDDAWFAALGRSCIHMTWSDRGAISL 134
D LG I+SG +T +Y+ L+ D A LG + G I +
Sbjct: 61 EQLADSYHKLGLFSITADKIISSGMITKEYIDLKVDGGIVAYLGTANSANYLVSDG-IKM 119
Query: 135 EGLGLKVVENVEEADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKKIPMVVANPD 194
+ N+ E + ++ EG DL K + + + IP +VAN D
Sbjct: 120 LPVSAIDDSNIGEVNALVLLDDEGFNWF---------HDLNKTVNLLRKRTIPAIVANTD 170
Query: 195 YVT-VEARALRVMPGTLASKFEK-LGGEVRWMGKPDKIIYKSAMAMV----GVDACDSIA 248
+ + + G +A+ E LG GKPD ++ A M+ + + +
Sbjct: 171 NTYPLTKTDVAIAIGGVATMIESILGRRFIRFGKPDSQMFMFAYDMLRQKMEISKREILM 230
Query: 249 VGDSLHHDIKGANAAGIQSVFIIGGIHATELGLDSYGEVADLSSVQTLVSKYDAYPSYVL 308
VGD+LH DI G N G+ + ++ G + +T + P+++
Sbjct: 231 VGDTLHTDILGGNKFGLDTALVLTGNTRID-------------DAETKIKSTGIVPTHIC 277
Query: 309 PSF 311
S
Sbjct: 278 ESA 280
|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Length = 263 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Length = 352 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Length = 251 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} Length = 240 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Length = 238 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Length = 260 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Length = 234 | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Length = 229 | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Length = 200 | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Length = 240 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Length = 211 | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 210 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Length = 282 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Length = 240 | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Length = 232 | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Length = 206 | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Length = 240 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Length = 253 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Length = 201 | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Length = 222 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Length = 261 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 100.0 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 100.0 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 100.0 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 100.0 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 100.0 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 100.0 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 100.0 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 100.0 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.98 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 99.97 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.95 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.94 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 99.85 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 99.84 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 99.84 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 99.83 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 99.83 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 99.82 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 99.81 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 99.81 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.8 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 99.79 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 99.79 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.78 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 99.78 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 99.78 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 99.78 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.78 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 99.78 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.78 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.77 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.77 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 99.77 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 99.77 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 99.76 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 99.76 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 99.76 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.76 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.76 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.75 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 99.75 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.75 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 99.75 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.75 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.75 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.74 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 99.73 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 99.73 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 99.73 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 99.73 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 99.73 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 99.73 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 99.73 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 99.73 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 99.72 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 99.71 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.71 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 99.71 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 99.71 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 99.71 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.71 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.71 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 99.7 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 99.7 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 99.69 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 99.68 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 99.68 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.68 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.67 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 99.67 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 99.67 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 99.67 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.66 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 99.66 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 99.66 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.66 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 99.66 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 99.65 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 99.65 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 99.65 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.64 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 99.64 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 99.63 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 99.63 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 99.62 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 99.62 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 99.61 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.61 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 99.61 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 99.6 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 99.6 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 99.59 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 99.58 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.58 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.58 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 99.57 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.57 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.57 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 99.56 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.56 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 99.55 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.54 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.54 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 99.51 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.51 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.5 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.48 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.47 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.46 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 99.46 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.44 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.43 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.43 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 99.43 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 99.42 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.41 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.39 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.38 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 99.36 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.35 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 99.34 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 99.32 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.31 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 99.3 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.26 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.25 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 99.22 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 99.22 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.19 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.19 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 99.17 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 99.15 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 99.1 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 98.64 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.02 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 99.0 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 98.96 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 98.9 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 98.76 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.69 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 98.53 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 98.48 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 98.37 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 98.05 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 97.99 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 97.94 | |
| 2jc9_A | 555 | Cytosolic purine 5'-nucleotidase; cytosolic 5-prim | 97.71 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 97.31 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 96.76 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 96.42 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 96.26 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 95.84 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 95.4 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 95.21 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 95.11 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 94.58 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 94.5 | |
| 4g63_A | 470 | Cytosolic IMP-GMP specific 5'-nucleotidase; struct | 94.13 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 93.89 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 93.57 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 93.21 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 92.98 | |
| 3geb_A | 274 | EYES absent homolog 2; hydrolase, activator, alter | 89.51 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 89.21 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 88.02 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 87.68 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 86.61 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 86.29 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 85.76 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 85.69 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 85.43 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 84.53 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 84.2 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 83.77 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 83.11 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 82.89 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 82.81 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 82.31 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 81.97 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 81.68 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 81.16 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 80.12 |
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5e-34 Score=253.77 Aligned_cols=247 Identities=20% Similarity=0.329 Sum_probs=201.2
Q ss_pred cCccEEEEeccceeecCCccCccHHHHHHHHHHCCCcEEEEeCC-CCCchHHHHHHHhCCCCCcccccccchHHHHHHHH
Q 021393 28 RRFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNS-SRRASTTIDKLKSLGFDPSLFAGAITSGELTHQYL 106 (313)
Q Consensus 28 ~~~k~iifDlDGTL~~~~~~~~~a~~~l~~l~~~g~~~~~~Tn~-~~~~~~~~~~l~~~G~~~~~~~~ii~~~~~~~~~l 106 (313)
|+||+|+||+||||+++.+.+|++.++|++++++|++++++||+ +|+...+...++++|+.... +++++++.+...++
T Consensus 3 m~~kli~~DlDGTLl~~~~~i~~~~eal~~l~~~G~~vvl~Tn~~gr~~~~~~~~l~~lg~~~~~-~~ii~~~~~~~~~l 81 (264)
T 3epr_A 3 LAYKGYLIDLDGTIYKGKSRIPAGERFIERLQEKGIPYMLVTNNTTRTPESVQEMLRGFNVETPL-ETIYTATMATVDYM 81 (264)
T ss_dssp CCCCEEEECCBTTTEETTEECHHHHHHHHHHHHHTCCEEEEECCCSSCHHHHHHHHHTTTCCCCG-GGEEEHHHHHHHHH
T ss_pred CCCCEEEEeCCCceEeCCEECcCHHHHHHHHHHCCCeEEEEeCCCCCCHHHHHHHHHHCCCCCCh-hheecHHHHHHHHH
Confidence 47999999999999999999999999999999999999999985 57788999999999998877 89999999999888
Q ss_pred HhcCchhhhhcCCeEEEeecCcccchhhccCCccccCCCCCCCEEEecCCCCCCCCCCCCCCCCHHHHHHHHHHHHhCCC
Q 021393 107 LRRDDAWFAALGRSCIHMTWSDRGAISLEGLGLKVVENVEEADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKKI 186 (313)
Q Consensus 107 ~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~g~ 186 (313)
.+... +..++.... ......+.+.|+.+.. ..++.++. +.+..+.++.+..++..+ +++.
T Consensus 82 ~~~~~------~~~~~~~~~-~~l~~~l~~~g~~~~~--~~~~~v~~----------~~~~~~~~~~~~~~~~~l-~~~~ 141 (264)
T 3epr_A 82 NDMNR------GKTAYVIGE-EGLKKAIADAGYVEDT--KNPAYVVV----------GLDWNVTYDKLATATLAI-QNGA 141 (264)
T ss_dssp HHHTC------CSEEEEESC-HHHHHHHHHTTCEECS--SSCSEEEE----------CCCTTCCHHHHHHHHHHH-HTTC
T ss_pred HHhCC------CCeEEEECC-HHHHHHHHHcCCcccC--CcCCEEEE----------eCCCCCCHHHHHHHHHHH-HCCC
Confidence 76541 344444332 2334467778887654 55666665 233567889999888776 5788
Q ss_pred cEEEEcCCccccccchhccCCchHHHHHHH-hcCceeecCCCCHHHHHHHHHHhCCCCCcEEEEcCCchhhHHHHHHcCC
Q 021393 187 PMVVANPDYVTVEARALRVMPGTLASKFEK-LGGEVRWMGKPDKIIYKSAMAMVGVDACDSIAVGDSLHHDIKGANAAGI 265 (313)
Q Consensus 187 ~~i~tn~d~~~~~~~~~~~~~g~~~~~~~~-~~~~~~~~gKP~~~~~~~~~~~lgv~~~~~v~IGDs~~~Di~~a~~aG~ 265 (313)
+++++|.+...+......+..+.+...++. ++.+....+||+|.+|+.+++++|++|++|+||||++.+||.||+++|+
T Consensus 142 ~~i~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Kp~~~~~~~~~~~~~~~~~~~~~vGD~~~~Di~~a~~aG~ 221 (264)
T 3epr_A 142 LFIGTNPDLNIPTERGLLPGAGSLNALLEAATRIKPVFIGKPNAIIMNKALEILNIPRNQAVMVGDNYLTDIMAGINNDI 221 (264)
T ss_dssp EEEESCCCSEEEETTEEEECHHHHHHHHHHHHSCCCEECSTTSHHHHHHHHHHHTSCGGGEEEEESCTTTHHHHHHHHTC
T ss_pred eEEEEcCCccccCCCceecCccHHHHHHHHHhCCCcccCCCCCHHHHHHHHHHhCcCcccEEEECCCcHHHHHHHHHCCC
Confidence 889999988766554444555677787876 5788899999999999999999999999999999995599999999999
Q ss_pred cEEEEcCCCCCCcccccCCCCccchhhHHHHHhhcCCCCcEEecCCc
Q 021393 266 QSVFIIGGIHATELGLDSYGEVADLSSVQTLVSKYDAYPSYVLPSFS 312 (313)
Q Consensus 266 ~~i~V~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~l~ 312 (313)
.+++|.+|.+..++ +......|+|++++|+
T Consensus 222 ~~~~v~~g~~~~~~-----------------~~~~~~~pd~~~~~l~ 251 (264)
T 3epr_A 222 DTLLVTTGFTTVEE-----------------VPDLPIQPSYVLASLD 251 (264)
T ss_dssp EEEEETTSSSCGGG-----------------GGGCSSCCSEEESCGG
T ss_pred eEEEECCCCCChHH-----------------HHhcCCCCCEEECCHH
Confidence 99999999987766 3333468999998875
|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 313 | ||||
| d1yv9a1 | 253 | c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En | 7e-27 | |
| d1vjra_ | 261 | c.108.1.14 (A:) Hypothetical protein TM1742 {Therm | 2e-26 | |
| d1wvia_ | 253 | c.108.1.14 (A:) Putative phosphatase SMU.1415c {St | 7e-26 | |
| d2c4na1 | 250 | c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId | 8e-21 | |
| d1qq5a_ | 245 | c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan | 5e-07 | |
| d1cr6a1 | 222 | c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal | 2e-06 | |
| d2fi1a1 | 187 | c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str | 9e-06 | |
| d1zs9a1 | 253 | c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien | 1e-05 | |
| d2g80a1 | 225 | c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast | 2e-05 | |
| d1x42a1 | 230 | c.108.1.1 (A:1-230) Hypothetical protein PH0459 {A | 2e-05 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 3e-05 | |
| d2b0ca1 | 197 | c.108.1.2 (A:8-204) Putative phosphatase YihX {Esc | 7e-05 | |
| d2fpwa1 | 161 | c.108.1.19 (A:3-163) Histidine biosynthesis bifunc | 1e-04 | |
| d2go7a1 | 204 | c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S | 1e-04 | |
| d2o2xa1 | 209 | c.108.1.19 (A:8-216) Hypothetical protein Mll2559 | 2e-04 | |
| d1u7pa_ | 164 | c.108.1.17 (A:) Magnesium-dependent phosphatase-1, | 2e-04 | |
| d1te2a_ | 218 | c.108.1.6 (A:) Phosphatase YniC {Escherichia coli | 2e-04 | |
| d2gfha1 | 247 | c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatas | 4e-04 | |
| d1zd3a1 | 225 | c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal | 6e-04 | |
| d1o08a_ | 221 | c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcu | 0.001 |
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NagD-like domain: Putative hydrolase EF1188 species: Enterococcus faecalis [TaxId: 1351]
Score = 104 bits (258), Expect = 7e-27
Identities = 50/285 (17%), Positives = 97/285 (34%), Gaps = 39/285 (13%)
Query: 30 FKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISN-SSRRASTTIDKLKSLGFD 88
++ +L+D G ++ GK+P P +E L + ++N +++ T +L +
Sbjct: 2 YQGYLIDLDGTIYLGKEPIPAGKRFVERLQEKDLPFLFVTNNTTKSPETVAQRLANEFDI 61
Query: 89 PSLFAGAITSGELTHQYLLRRDDAWFAALGRSCIHMTWSDRGAISLEGLGLKVVENVEEA 148
+ T+ T Y+ + + + + G + E
Sbjct: 62 HVPASLVYTATLATIDYMKEANRGK-------KVFVIGEAGLIDLILEAGFEWDE--TNP 112
Query: 149 DFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKKIPMVVANPDYVTVEARALRVMPG 208
D+++ + + +++Q K + NPD R L G
Sbjct: 113 DYVVVGLDTELSYEKVVLATLAIQ-----------KGALFIGTNPDKNIPTERGLLPGAG 161
Query: 209 -TLASKFEKLGGEVRWMGKPDKIIYKSAMAMVGVDACDSIAVGDSLHHDIKGANAAGIQS 267
+ + ++GKP II + A+A +GV+ I VGD+ DI+ GI S
Sbjct: 162 SVVTFVETATQTKPVYIGKPKAIIMERAIAHLGVEKEQVIMVGDNYETDIQSGIQNGIDS 221
Query: 268 VFIIGGIHATELGLDSYGEVADLSSVQTLVSKYDAYPSYVLPSFS 312
+ + G V P+YV+ S
Sbjct: 222 LLVTSGFTPKS-----------------AVPTLPTPPTYVVDSLD 249
|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Length = 261 | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 225 | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Length = 197 | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Length = 209 | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Length = 218 | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Length = 247 | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 225 | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Length = 221 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 100.0 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 100.0 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 100.0 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 99.82 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 99.81 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 99.81 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 99.79 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 99.79 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 99.79 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 99.77 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 99.77 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 99.77 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 99.77 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 99.76 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 99.76 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 99.75 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 99.72 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 99.71 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 99.71 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 99.71 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 99.71 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 99.7 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 99.69 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 99.62 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 99.6 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 99.59 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.54 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 99.51 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 99.45 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.43 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 99.41 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 99.4 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 99.37 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.34 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.28 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 99.28 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 99.21 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.14 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.13 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 99.12 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 98.97 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 98.96 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 98.84 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 98.75 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 98.7 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 98.64 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 98.61 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 98.08 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 97.95 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.78 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 97.47 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 97.04 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 94.41 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 91.81 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 90.85 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 90.44 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 90.33 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 90.2 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 90.01 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 89.5 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 89.06 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 87.43 | |
| d2bdea1 | 458 | Cytosolic IMP-GMP specific 5'-nucleotidase {Legion | 87.07 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 83.81 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 83.35 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 80.8 |
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NagD-like domain: Putative phosphatase SMU.1415c species: Streptococcus mutans [TaxId: 1309]
Probab=100.00 E-value=1.1e-37 Score=273.92 Aligned_cols=246 Identities=21% Similarity=0.312 Sum_probs=197.7
Q ss_pred CccEEEEeccceeecCCccCccHHHHHHHHHHCCCcEEEEeCCC-CCchHHHHHHH-hCCCCCcccccccchHHHHHHHH
Q 021393 29 RFKAWLLDQFGVLHDGKKPYPGAISTLEMLATTGAKMVVISNSS-RRASTTIDKLK-SLGFDPSLFAGAITSGELTHQYL 106 (313)
Q Consensus 29 ~~k~iifDlDGTL~~~~~~~~~a~~~l~~l~~~g~~~~~~Tn~~-~~~~~~~~~l~-~~G~~~~~~~~ii~~~~~~~~~l 106 (313)
+||+|+||+||||+++.+++|+|.+++++|++.|++++++||++ ++.+.+.+.+. .+|++... +.++++..++.+++
T Consensus 1 tyk~vlFDlDGTL~~~~~~i~~a~e~l~~l~~~g~~~~~~TN~s~~~~~~~~~~l~~~~~~~~~~-~~i~~~~~~~~~~l 79 (253)
T d1wvia_ 1 TYKGYLIDLDGTIYKGKDRIPAGEDFVKRLQERQLPYILVTNNTTRTPEMVQEMLATSFNIKTPL-ETIYTATLATIDYM 79 (253)
T ss_dssp CCCEEEEECBTTTEETTEECHHHHHHHHHHHHHTCCEEEEECCCSSCHHHHHHHHHHHHSCCCCG-GGEEEHHHHHHHHH
T ss_pred CcCEEEEcCcCceEECCCcCccHHHHHHHHHHCCCCEEEEeCCCCCCHHHHHHHHHhhcCccccc-cccccHHHHHHHHH
Confidence 58999999999999999999999999999999999999999966 55567888885 57888777 89999999999999
Q ss_pred HhcCchhhhhcCCeEEEeecCcccchhhccCCccccCCCCCCCEEEecCCCCCCCCCCCCCCCCHHHHHHHHHHHHhCCC
Q 021393 107 LRRDDAWFAALGRSCIHMTWSDRGAISLEGLGLKVVENVEEADFILAHGTEGMGLPSGDVRPMSLQDLEKILEICASKKI 186 (313)
Q Consensus 107 ~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~g~ 186 (313)
++... +.+++.+.. ......+.+.+..... +.+...+. +.+..+++........ +.+.+.
T Consensus 80 ~~~~~------~~~~~~~~~-~~l~~~~~~~~~~~~~--~~~~~~~~----------~~~~~~~~~~~~~~~~-~~~~~~ 139 (253)
T d1wvia_ 80 NDMKR------GKTAYVIGE-TGLKKAVAEAGYREDS--ENPAYVVV----------GLDTNLTYEKLTLATL-AIQKGA 139 (253)
T ss_dssp HHHCC------CSEEEEESC-HHHHHHHHHTTCEECS--SSCSEEEE----------CCCTTCBHHHHHHHHH-HHHTTC
T ss_pred HHhcc------Cceeeeccc-hHHHHHHHHcCCcccc--cccceEEE----------ecCCCcCHHHHHHHhh-hhhhcc
Confidence 87763 455554432 2223356666664433 45555555 2345566665555543 345677
Q ss_pred cEEEEcCCccccccchhccCCchHHHHHHH-hcCceeecCCCCHHHHHHHHHHhCCCCCcEEEEcCCchhhHHHHHHcCC
Q 021393 187 PMVVANPDYVTVEARALRVMPGTLASKFEK-LGGEVRWMGKPDKIIYKSAMAMVGVDACDSIAVGDSLHHDIKGANAAGI 265 (313)
Q Consensus 187 ~~i~tn~d~~~~~~~~~~~~~g~~~~~~~~-~~~~~~~~gKP~~~~~~~~~~~lgv~~~~~v~IGDs~~~Di~~a~~aG~ 265 (313)
++++||++..++....+..+.+.+...++. .+.++..+|||+|.+|+.+++++|++|++|+||||++.+||++|+++|+
T Consensus 140 ~~i~tn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gKP~p~~~~~al~~l~i~~~~~~mIGDs~~~DI~gA~~aG~ 219 (253)
T d1wvia_ 140 VFIGTNPDLNIPTERGLLPGAGAILFLLEKATRVKPIIIGKPEAVIMNKALDRLGVKRHEAIMVGDNYLTDITAGIKNDI 219 (253)
T ss_dssp EEEESCCCSEEEETTEEEECHHHHHHHHHHHHCCCCEECSTTSHHHHHHHHHHHTSCGGGEEEEESCTTTTHHHHHHTTC
T ss_pred ccccCCCCceeEcCCcccccCCcchhcccccccceeEEeccCCcccceehhhhccccccceEEEcCChHHHHHHHHHCCC
Confidence 889999999888877777777888887776 5888999999999999999999999999999999999789999999999
Q ss_pred cEEEEcCCCCCCcccccCCCCccchhhHHHHHhhcCCCCcEEecCCc
Q 021393 266 QSVFIIGGIHATELGLDSYGEVADLSSVQTLVSKYDAYPSYVLPSFS 312 (313)
Q Consensus 266 ~~i~V~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~l~ 312 (313)
++|+|+||.++.++ +.....+|||+++||+
T Consensus 220 ~si~V~~G~~~~~~-----------------~~~~~~~PD~vi~sl~ 249 (253)
T d1wvia_ 220 ATLLVTTGFTKPEE-----------------VPALPIQPDFVLSSLA 249 (253)
T ss_dssp EEEEESSSSSCTTT-----------------GGGCSSCCSEEESCGG
T ss_pred CEEEECCCCCCHHH-----------------HhhcCCCCCEEECCHH
Confidence 99999999987776 4456679999999987
|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|