Query         021420
Match_columns 312
No_of_seqs    171 out of 333
Neff          3.7 
Searched_HMMs 46136
Date          Fri Mar 29 02:49:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/021420.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/021420hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03110 SBP:  SBP domain;  Int 100.0 1.6E-40 3.5E-45  262.1  -0.1   78   23-100     1-78  (79)
  2 PRK06424 transcription factor;  46.3      12 0.00027   32.8   1.7   21   53-73     14-34  (144)
  3 PF14901 Jiv90:  Cleavage induc  45.0       8 0.00017   32.3   0.3   18   61-78     26-43  (94)
  4 PF09297 zf-NADH-PPase:  NADH p  35.4      19 0.00041   23.6   0.9   30   42-72      2-31  (32)
  5 PRK00241 nudC NADH pyrophospha  32.0      17 0.00037   34.3   0.3   36   37-73     93-128 (256)
  6 PF14776 UNC-79:  Cation-channe  31.3      23  0.0005   37.4   1.1   27   43-69    262-297 (525)
  7 TIGR03831 YgiT_finger YgiT-typ  26.4      36 0.00079   22.9   1.1   20   51-70     21-40  (46)
  8 COG2816 NPY1 NTP pyrophosphohy  23.8      32  0.0007   33.6   0.6   35   37-72    105-139 (279)
  9 PF02150 RNA_POL_M_15KD:  RNA p  23.8      27 0.00058   23.8   0.0   33   45-77      3-35  (35)
 10 TIGR00270 conserved hypothetic  22.2      55  0.0012   29.0   1.7   22   51-72     13-34  (154)
 11 PF09526 DUF2387:  Probable met  20.4      68  0.0015   25.3   1.7   26   44-69      9-37  (71)
 12 PF12108 SF3a60_bindingd:  Spli  20.1      19 0.00042   23.9  -1.2   11   33-43     16-26  (28)

No 1  
>PF03110 SBP:  SBP domain;  InterPro: IPR004333 The SBP plant protein domain is a sequence specific DNA-binding domain []. Proteins with this domain probably function as transcription factors involved in the control of early flower development. The domain contains 10 conserved cysteine and histidine residues that probably are zinc ligands.; GO: 0003677 DNA binding, 0005634 nucleus; PDB: 1UL4_A 1WJ0_A 1UL5_A.
Probab=100.00  E-value=1.6e-40  Score=262.13  Aligned_cols=78  Identities=63%  Similarity=1.158  Sum_probs=63.2

Q ss_pred             ceecCCCcccccccccccccccchhhhcCCCeEEECCeeeehhhhcccccccccccCcchhHHHHHhHHHhhhcCCCC
Q 021420           23 SCLVDGCTADLGKCRDYHRRHKVCEIHSKTPKVTIHGREQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQP  100 (312)
Q Consensus        23 ~CqV~GC~~dLs~~k~Y~rR~rvCe~H~ka~~V~v~G~~~RFCQQC~rFH~L~eFDg~kRSCR~rL~~hn~RRRk~q~  100 (312)
                      +||||||++||+.+|+||+||||||.|+|||+|+++|+++||||||+|||+|+||||+|||||++|++||+||||+++
T Consensus         1 ~CqV~gC~~dL~~~k~Y~rR~rICe~H~ka~~V~~~G~~~RFCQQC~rfh~l~eFdg~kRSCr~~L~~h~~RRr~~~~   78 (79)
T PF03110_consen    1 RCQVDGCGADLSGAKEYHRRYRICEEHAKAPVVVVDGVEQRFCQQCGRFHPLSEFDGGKRSCRARLARHNERRRKRQQ   78 (79)
T ss_dssp             C-SSTTEE-EETS--SSCCCTT--HHHHTHSEEEETTEEEEE-TTTSSEEETTCB-SSTTSBSTTTT-SSS---S-S-
T ss_pred             CCcCCCCCcchhhhHHHhhccCcchhhcCCCeEEECChhHHHHHHHHcCCCHHHHcchhhhHHHHHHHHHHHhccccC
Confidence            599999999999999999999999999999999999999999999999999999999999999999999999999876


No 2  
>PRK06424 transcription factor; Provisional
Probab=46.27  E-value=12  Score=32.83  Aligned_cols=21  Identities=33%  Similarity=0.767  Sum_probs=18.6

Q ss_pred             CeEEECCeeeehhhhcccccc
Q 021420           53 PKVTIHGREQRFCQQCSRFHS   73 (312)
Q Consensus        53 ~~V~v~G~~~RFCQQC~rFH~   73 (312)
                      -.|+|+|.+.+-|..|.+|=.
T Consensus        14 ~~v~ieg~~l~vC~~Ca~~G~   34 (144)
T PRK06424         14 TKVMIDGAILNVCDDCAKFGT   34 (144)
T ss_pred             eEEEEcCeeeehhHHHHHcCC
Confidence            468899999999999998854


No 3  
>PF14901 Jiv90:  Cleavage inducing molecular chaperone
Probab=45.04  E-value=8  Score=32.28  Aligned_cols=18  Identities=39%  Similarity=0.744  Sum_probs=14.7

Q ss_pred             eeehhhhccccccccccc
Q 021420           61 EQRFCQQCSRFHSLEEFD   78 (312)
Q Consensus        61 ~~RFCQQC~rFH~L~eFD   78 (312)
                      .-|+||+|..+|+..|=|
T Consensus        26 ~AR~C~~C~~~H~Ak~gD   43 (94)
T PF14901_consen   26 AARYCQDCKIRHPAKEGD   43 (94)
T ss_pred             hhHhHHHhhhhcccccCC
Confidence            469999999999876644


No 4  
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=35.41  E-value=19  Score=23.63  Aligned_cols=30  Identities=27%  Similarity=0.540  Sum_probs=17.5

Q ss_pred             cccchhhhcCCCeEEECCeeeehhhhccccc
Q 021420           42 RHKVCEIHSKTPKVTIHGREQRFCQQCSRFH   72 (312)
Q Consensus        42 R~rvCe~H~ka~~V~v~G~~~RFCQQC~rFH   72 (312)
                      +||.|... -++++.+.+...|-|+.|+..|
T Consensus         2 ~~rfC~~C-G~~t~~~~~g~~r~C~~Cg~~~   31 (32)
T PF09297_consen    2 NHRFCGRC-GAPTKPAPGGWARRCPSCGHEH   31 (32)
T ss_dssp             TTSB-TTT---BEEE-SSSS-EEESSSS-EE
T ss_pred             CCcccCcC-CccccCCCCcCEeECCCCcCEe
Confidence            56667654 5677778888888899888644


No 5  
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=32.04  E-value=17  Score=34.31  Aligned_cols=36  Identities=14%  Similarity=0.328  Sum_probs=26.8

Q ss_pred             ccccccccchhhhcCCCeEEECCeeeehhhhcccccc
Q 021420           37 RDYHRRHKVCEIHSKTPKVTIHGREQRFCQQCSRFHS   73 (312)
Q Consensus        37 k~Y~rR~rvCe~H~ka~~V~v~G~~~RFCQQC~rFH~   73 (312)
                      ..+|++||-|..+-....+ ..+...|.|..|++.|-
T Consensus        93 ~~w~~~~~fC~~CG~~~~~-~~~~~~~~C~~c~~~~y  128 (256)
T PRK00241         93 AEFYRSHRFCGYCGHPMHP-SKTEWAMLCPHCRERYY  128 (256)
T ss_pred             HHHhhcCccccccCCCCee-cCCceeEECCCCCCEEC
Confidence            4678899999988775544 45556788999997663


No 6  
>PF14776 UNC-79:  Cation-channel complex subunit UNC-79
Probab=31.26  E-value=23  Score=37.43  Aligned_cols=27  Identities=41%  Similarity=0.703  Sum_probs=21.5

Q ss_pred             ccchhhhcCCCeEEE---------CCeeeehhhhcc
Q 021420           43 HKVCEIHSKTPKVTI---------HGREQRFCQQCS   69 (312)
Q Consensus        43 ~rvCe~H~ka~~V~v---------~G~~~RFCQQC~   69 (312)
                      +|-|.-+.|..+|+-         ++++.|+||||.
T Consensus       262 nK~C~S~~k~AvvtCFS~eCt~~~gn~PiRlC~~Ch  297 (525)
T PF14776_consen  262 NKNCRSSDKSAVVTCFSTECTSYNGNRPIRLCQQCH  297 (525)
T ss_pred             CCCCcCCCCCeEEEEechhhccccCCCcchhHHHHh
Confidence            566777778777753         678899999997


No 7  
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=26.39  E-value=36  Score=22.85  Aligned_cols=20  Identities=20%  Similarity=0.411  Sum_probs=17.4

Q ss_pred             CCCeEEECCeeeehhhhccc
Q 021420           51 KTPKVTIHGREQRFCQQCSR   70 (312)
Q Consensus        51 ka~~V~v~G~~~RFCQQC~r   70 (312)
                      +...+++.+.+..+|.+|+.
T Consensus        21 ~~~~~~i~~vp~~~C~~CGE   40 (46)
T TIGR03831        21 GGELIVIENVPALVCPQCGE   40 (46)
T ss_pred             CCEEEEEeCCCccccccCCC
Confidence            56778899999999999984


No 8  
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=23.81  E-value=32  Score=33.64  Aligned_cols=35  Identities=26%  Similarity=0.527  Sum_probs=29.0

Q ss_pred             ccccccccchhhhcCCCeEEECCeeeehhhhccccc
Q 021420           37 RDYHRRHKVCEIHSKTPKVTIHGREQRFCQQCSRFH   72 (312)
Q Consensus        37 k~Y~rR~rvCe~H~ka~~V~v~G~~~RFCQQC~rFH   72 (312)
                      -++|++||.|.. +-+++...+|...|-|++|+.-|
T Consensus       105 ~~w~~~~RFCg~-CG~~~~~~~~g~~~~C~~cg~~~  139 (279)
T COG2816         105 LEWYRSHRFCGR-CGTKTYPREGGWARVCPKCGHEH  139 (279)
T ss_pred             HHHHhhCcCCCC-CCCcCccccCceeeeCCCCCCcc
Confidence            467899999986 46678888999999999998654


No 9  
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=23.77  E-value=27  Score=23.82  Aligned_cols=33  Identities=12%  Similarity=0.284  Sum_probs=20.4

Q ss_pred             chhhhcCCCeEEECCeeeehhhhcccccccccc
Q 021420           45 VCEIHSKTPKVTIHGREQRFCQQCSRFHSLEEF   77 (312)
Q Consensus        45 vCe~H~ka~~V~v~G~~~RFCQQC~rFH~L~eF   77 (312)
                      -|+.....+.+.-+....+.|..|+--++++.|
T Consensus         3 FCp~C~nlL~p~~~~~~~~~C~~C~Y~~~~~~~   35 (35)
T PF02150_consen    3 FCPECGNLLYPKEDKEKRVACRTCGYEEPISQF   35 (35)
T ss_dssp             BETTTTSBEEEEEETTTTEEESSSS-EEE-SS-
T ss_pred             eCCCCCccceEcCCCccCcCCCCCCCccCCCCC
Confidence            466666666666554444489999988888776


No 10 
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=22.15  E-value=55  Score=29.01  Aligned_cols=22  Identities=36%  Similarity=0.753  Sum_probs=18.8

Q ss_pred             CCCeEEECCeeeehhhhccccc
Q 021420           51 KTPKVTIHGREQRFCQQCSRFH   72 (312)
Q Consensus        51 ka~~V~v~G~~~RFCQQC~rFH   72 (312)
                      +.-.|.|+|.+..-|..|.+|=
T Consensus        13 ~~~~v~iega~l~vC~~C~k~G   34 (154)
T TIGR00270        13 KGFKIVIEGSEMTVCGECRKFG   34 (154)
T ss_pred             CCeEEEEcCeEEehhhhHHhcC
Confidence            3457889999999999999883


No 11 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=20.37  E-value=68  Score=25.29  Aligned_cols=26  Identities=23%  Similarity=0.508  Sum_probs=23.2

Q ss_pred             cchhhhcCCCeEEE---CCeeeehhhhcc
Q 021420           44 KVCEIHSKTPKVTI---HGREQRFCQQCS   69 (312)
Q Consensus        44 rvCe~H~ka~~V~v---~G~~~RFCQQC~   69 (312)
                      -+|+.+....+|++   +|.+.|.|=.|+
T Consensus         9 a~CP~C~~~D~i~~~~e~~ve~vECV~CG   37 (71)
T PF09526_consen    9 AVCPKCQAMDTIMMWRENGVEYVECVECG   37 (71)
T ss_pred             ccCCCCcCccEEEEEEeCCceEEEecCCC
Confidence            47999999998875   899999999998


No 12 
>PF12108 SF3a60_bindingd:  Splicing factor SF3a60 binding domain;  InterPro: IPR021966  This domain is found in eukaryotes. This domain is about 30 amino acids in length. This domain has a single completely conserved residue Y that may be functionally important. SF3a60 makes up the SF3a complex with SF3a66 and SF3a120. This domain is the binding site of SF3a60 for SF3a120. The SF3a complex is part of the spliceosome, a protein complex involved in splicing mRNA after transcription. ; PDB: 2DT7_A.
Probab=20.11  E-value=19  Score=23.95  Aligned_cols=11  Identities=45%  Similarity=0.890  Sum_probs=7.1

Q ss_pred             ccccccccccc
Q 021420           33 LGKCRDYHRRH   43 (312)
Q Consensus        33 Ls~~k~Y~rR~   43 (312)
                      |..+|+||+||
T Consensus        16 lk~Ike~Hrr~   26 (28)
T PF12108_consen   16 LKEIKEYHRRY   26 (28)
T ss_dssp             HHHHHHHHHS-
T ss_pred             HHHHHHHHHhC
Confidence            55667788776


Done!