Citrus Sinensis ID: 021448

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MNPESFTLPRATVTDYRLLKEAMLTSLPSPEMEDAVFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREALEKLAQSMPVNCDVCEIFDDIDEKFEIEAAKQKLHELCGKKKWPKPSYK
cccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHccccccccHHHHHHHHccccccccccccccEEEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccc
***********TVTDYRLLKEAMLTSL****MEDAVFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTA**GGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVAS*****K**AKLNAAREALEKLAQSMPVNCD*************IEAAKQKLHELCGKKKWPKP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPESFTLPRATVTDYRLLKEAMLTSLPSPEMEDAVFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASxxxxxxxxxxxxxxxxxxxxxAQSMPVNCDVCEIFDDIDEKFEIEAAKQKLHELCGKKKWPKPSYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribonuclease 3-like protein 2 Cleaves double-stranded RNA (dsRNA).probableQ6ATG6
Ribonuclease 3-like protein 2 Ribonuclease that cleaves double-stranded RNA (dsRNA). Required for 3'-external transcribed spacer (ETS) cleavage of the pre-rRNA precursors. May promote the production of 21 nucleotide small interfering RNA (siRNA) during post-transcriptional gene silencing (PTGS).probableQ9LTQ0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3C4B, chain A
Confidence level:very confident
Coverage over the Query: 35-254
View the alignment between query and template
View the model in PyMOL
Template: 2YT4, chain A
Confidence level:very confident
Coverage over the Query: 204-312
View the alignment between query and template
View the model in PyMOL