Citrus Sinensis ID: 021466


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSKEPAKPKAQAEPKKEAAKETAKPKVEDAGEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKVRGSFDGFLFPPGQVC
ccEEEccccccHHHHHHHHHHHHccccEEEEEcccccccccccHHHHccccccccEEEccccEEEcHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcHHHHHHHcccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccHHccccccccccHHHHHccccccccccccccccc
MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAE*******************************************************LDLLPPSKMILDEWKRLYSNTKTNFREVAIKVRGSFDGFLFPPGQVC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLVLHAGNTNKNAFKALITAEYTGVNVELVKNFEMGVTNKTPEFLKMNPIGKVPVLETPDGPIFESNAIARYVARLKADNPLLGSSLIDSAHIEQWIDFSSLEIDTNILRWFIPRVGFAVYLPQAEEAAIASLKRALAALNTHLASNTYLVGHSVTLADIIMTCNLTLGFSRILSKSFTSEFPHIERYFWTMVNIPNFRKILGEIKQAESVPPVQSAKKPTQSKEPAKPKAQAEPKKEAAKETAKPKVEDAGEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKVRGSFDGFLFPPGQVC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor 1-gamma 2 Probably plays a role in anchoring the complex to other cellular components.probableQ6YW46
Elongation factor 1-gamma 3 Probably plays a role in anchoring the complex to other cellular components.probableQ5Z627
Probable elongation factor 1-gamma 1 Probably plays a role in anchoring the complex to other cellular components.probableO04487

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NHY, chain A
Confidence level:very confident
Coverage over the Query: 2-212
View the alignment between query and template
View the model in PyMOL
Template: 1PBU, chain A
Confidence level:probable
Coverage over the Query: 263-296
View the alignment between query and template
View the model in PyMOL