BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021496
         (311 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1VE5|A Chain A, Crystal Structure Of T.Th. Hb8 Threonine Deaminase
 pdb|1VE5|B Chain B, Crystal Structure Of T.Th. Hb8 Threonine Deaminase
 pdb|1VE5|C Chain C, Crystal Structure Of T.Th. Hb8 Threonine Deaminase
 pdb|1VE5|D Chain D, Crystal Structure Of T.Th. Hb8 Threonine Deaminase
          Length = 311

 Score = 31.2 bits (69), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 139 DLVRRGQLRSDRRGISRPLKYED------PFNNPLVKVGKSNSTMEMCGKVYRLA 187
           ++V RG    +R  ++R L+ E       PF++PLV  G+  + +E+  +  R+ 
Sbjct: 113 EVVDRGVTAKNREEVARALQEETGYALIHPFDDPLVIAGQGTAGLELLAQAGRMG 167


>pdb|1O7D|D Chain D, The Structure Of The Bovine Lysosomal A-Mannosidase
           Suggests A Novel Mechanism For Low Ph Activation
          Length = 282

 Score = 27.7 bits (60), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 133 RPGSVEDLVRRGQLRSDRRGISRPLKYE 160
           R GS+E +V R  L+ D RG+  PL  E
Sbjct: 203 RDGSLELMVHRRLLKDDARGVGEPLNKE 230


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.134    0.400 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,564,785
Number of Sequences: 62578
Number of extensions: 320332
Number of successful extensions: 649
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 648
Number of HSP's gapped (non-prelim): 5
length of query: 311
length of database: 14,973,337
effective HSP length: 99
effective length of query: 212
effective length of database: 8,778,115
effective search space: 1860960380
effective search space used: 1860960380
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)