BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021499
         (311 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2RCF|A Chain A, Carboxysome Shell Protein, Orfa From H. Neapolitanus
 pdb|2RCF|B Chain B, Carboxysome Shell Protein, Orfa From H. Neapolitanus
 pdb|2RCF|C Chain C, Carboxysome Shell Protein, Orfa From H. Neapolitanus
 pdb|2RCF|D Chain D, Carboxysome Shell Protein, Orfa From H. Neapolitanus
 pdb|2RCF|E Chain E, Carboxysome Shell Protein, Orfa From H. Neapolitanus
          Length = 91

 Score = 28.5 bits (62), Expect = 4.5,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 234 WKMAGLPRQASVEHRGMVPGELIL 257
           W+  G PRQ +V+  G +PG+ +L
Sbjct: 28  WEKPGAPRQVAVDAIGCIPGDWVL 51


>pdb|3TLX|A Chain A, Crystal Structure Of Pf10_0086, Adenylate Kinase From
           Plasmodium Falciparum
 pdb|3TLX|B Chain B, Crystal Structure Of Pf10_0086, Adenylate Kinase From
           Plasmodium Falciparum
 pdb|3TLX|C Chain C, Crystal Structure Of Pf10_0086, Adenylate Kinase From
           Plasmodium Falciparum
 pdb|3TLX|D Chain D, Crystal Structure Of Pf10_0086, Adenylate Kinase From
           Plasmodium Falciparum
          Length = 243

 Score = 27.7 bits (60), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 3/50 (6%)

Query: 80  GVFMLLYLPIRRYVLKKDISSRKLYVTPSEIVYKVSRPSFIPFWGKTTNE 129
           GVF   Y  +   VL   IS R ++     I +K+  P  +PF    TNE
Sbjct: 138 GVF---YFNVPDEVLVNRISGRLIHKPSGRIYHKIFNPPKVPFRDDVTNE 184


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,733,692
Number of Sequences: 62578
Number of extensions: 277101
Number of successful extensions: 582
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 581
Number of HSP's gapped (non-prelim): 3
length of query: 311
length of database: 14,973,337
effective HSP length: 99
effective length of query: 212
effective length of database: 8,778,115
effective search space: 1860960380
effective search space used: 1860960380
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)