Citrus Sinensis ID: 021506

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-

MAVGLLAAIVPKPFCLLTTKLQPSSLLTTKPAPLFAPLGTHRGFFNGKNRRKLNSFTVCFVLEEKKQSTQIETFTEEEEEESGTQISTAARVAEKLARKRSERFTYLVAAVMSSFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPKELEEVGGLEELEKEISKRIKSYNRVPK

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHEEEcCEEccccccccccccHHHHHHHHHHHHcccccccccccEEEEcccHHHHcccHHHHHHHHHHHHHHHccccc

***GLLAAIVPKPFCLLTT*LQPSSLLTTKPAPLFAPLGTHRGFFNGKNRRKLNSFTVCFVLE**************************************ERFTYLVAAVMSSFGITSMAVMAVYYRFWWQMEGGEVPLAEMFGTFALSVGAAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHSDKFHGVPYGLFLGPKELE************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Beta-carotene 3-hydroxylase 1, chloroplastic	Nonheme diiron monooxygenase involved in the biosynthesis of xanthophylls. Specific for beta-ring hydroxylations of beta-carotene. Has also a low activity toward the beta- and epsilon-rings of alpha-carotene. No activity with acyclic carotenoids such as lycopene and neurosporene. Uses ferredoxin as an electron donor.	confident	Q9SZZ8
Beta-carotene hydroxylase 2, chloroplastic (Fragment)	Nonheme diiron monooxygenase involved in the biosynthesis of xanthophylls. Specific for beta-ring hydroxylations of beta-carotene. Produces beta-cryptoxanthin and zeaxanthin. Uses ferredoxin as an electron donor.	probable	O49814
Beta-carotene hydroxylase 1, chloroplastic	Nonheme diiron monooxygenase involved in the biosynthesis of xanthophylls. Specific for beta-ring hydroxylations of beta-carotene. Produces beta-cryptoxanthin and zeaxanthin. Uses ferredoxin as an electron donor.	probable	O49815

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3J1Z, chain P
Confidence level:probable
Coverage over the Query: 91-177,189-262
View the alignment between query and template
View the model in PyMOL