BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 021514
(311 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1K0E|A Chain A, The Crystal Structure Of Aminodeoxychorismate Synthase
From Formate Grown Crystals
pdb|1K0E|B Chain B, The Crystal Structure Of Aminodeoxychorismate Synthase
From Formate Grown Crystals
pdb|1K0G|A Chain A, The Crystal Structure Of Aminodeoxychorismate Synthase
From Phosphate Grown Crystals
pdb|1K0G|B Chain B, The Crystal Structure Of Aminodeoxychorismate Synthase
From Phosphate Grown Crystals
Length = 453
Score = 29.6 bits (65), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 21/103 (20%)
Query: 192 HLPMQLSQVDPIVASFSGGAVG---VISALMLIEANNVEQQEKKRCKYCHGSGYLACARC 248
LP QL D + A+F GG++ + A+ +I+ E + ++R +C GYL+ C
Sbjct: 347 QLPEQLHASDLLRAAFPGGSITGAPKVRAMEIID----ELEPQRRNAWCGSIGYLSF--C 400
Query: 249 SSSGVCLSVDPISTSNASNGPLRVPTTQRCPNCSGAGKVMCPS 291
+ ++ I T A NG + CS G ++ S
Sbjct: 401 GNMDTSIT---IRTLTAINGQI---------FCSAGGGIVADS 431
>pdb|3LCZ|A Chain A, B.Licheniformis Anti-Trap Can Assemble Into Two Types Of
Dodecameric Particles With The Same Symmetry But
Inverted Orientation Of Trimers
pdb|3LCZ|B Chain B, B.Licheniformis Anti-Trap Can Assemble Into Two Types Of
Dodecameric Particles With The Same Symmetry But
Inverted Orientation Of Trimers
pdb|3LCZ|C Chain C, B.Licheniformis Anti-Trap Can Assemble Into Two Types Of
Dodecameric Particles With The Same Symmetry But
Inverted Orientation Of Trimers
pdb|3LCZ|D Chain D, B.Licheniformis Anti-Trap Can Assemble Into Two Types Of
Dodecameric Particles With The Same Symmetry But
Inverted Orientation Of Trimers
pdb|3LD0|A Chain A, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|B Chain B, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|C Chain C, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|D Chain D, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|E Chain E, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|F Chain F, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|G Chain G, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|H Chain H, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|I Chain I, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|J Chain J, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|K Chain K, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|L Chain L, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|M Chain M, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|N Chain N, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|O Chain O, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|P Chain P, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|Q Chain Q, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|R Chain R, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|S Chain S, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|T Chain T, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|U Chain U, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|V Chain V, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|W Chain W, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|X Chain X, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|Y Chain Y, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|Z Chain Z, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|1 Chain 1, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|2 Chain 2, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|3 Chain 3, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|4 Chain 4, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|5 Chain 5, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|6 Chain 6, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|7 Chain 7, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|8 Chain 8, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|9 Chain 9, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|AA Chain a, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|BB Chain b, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|CC Chain c, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|DD Chain d, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|EE Chain e, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|FF Chain f, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|GG Chain g, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|HH Chain h, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|II Chain i, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|JJ Chain j, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|KK Chain k, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|LL Chain l, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
pdb|3LD0|MM Chain m, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
Antagonist Of Trap-Rna Interactions
Length = 53
Score = 27.7 bits (60), Expect = 8.5, Method: Compositional matrix adjust.
Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 3/28 (10%)
Query: 278 CPNCSGAGKVM---CPSCLCTGMMMASE 302
CPNC+G+G+ CP CL G+++ ++
Sbjct: 12 CPNCNGSGREEPEPCPKCLGKGVILTAQ 39
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.134 0.405
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,798,150
Number of Sequences: 62578
Number of extensions: 271205
Number of successful extensions: 715
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 697
Number of HSP's gapped (non-prelim): 20
length of query: 311
length of database: 14,973,337
effective HSP length: 99
effective length of query: 212
effective length of database: 8,778,115
effective search space: 1860960380
effective search space used: 1860960380
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)