Query 021515
Match_columns 311
No_of_seqs 222 out of 528
Neff 3.9
Searched_HMMs 46136
Date Fri Mar 29 03:35:54 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/021515.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/021515hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF10533 Plant_zn_clust: Plant 99.5 8.5E-15 1.8E-19 105.8 3.6 46 238-283 1-47 (47)
2 smart00774 WRKY DNA binding do 99.3 9.8E-13 2.1E-17 99.2 1.9 25 285-309 1-29 (59)
3 PF03106 WRKY: WRKY DNA -bindi 99.3 3.1E-13 6.8E-18 101.8 -1.1 26 285-310 1-30 (60)
4 PF05344 DUF746: Domain of Unk 90.6 0.43 9.3E-06 37.3 4.1 57 36-109 2-60 (65)
5 PF03859 CG-1: CG-1 domain; I 30.6 16 0.00034 31.6 -0.1 9 285-293 51-59 (118)
6 PF07516 SecA_SW: SecA Wing an 17.9 46 0.001 30.1 0.3 6 291-296 174-179 (214)
7 PF08257 Sulfakinin: Sulfakini 17.8 49 0.0011 16.9 0.2 7 97-103 3-9 (9)
8 PF11946 DUF3463: Domain of un 16.5 61 0.0013 28.8 0.7 17 287-308 93-109 (138)
9 COG4283 Uncharacterized conser 14.9 66 0.0014 29.5 0.5 12 284-295 75-86 (170)
10 KOG0673 Thymidylate synthase [ 13.7 64 0.0014 31.5 0.1 23 284-306 112-155 (293)
No 1
>PF10533 Plant_zn_clust: Plant zinc cluster domain; InterPro: IPR018872 This zinc binding domain is found associated with the WRKY domain IPR003657 from INTERPRO [].
Probab=99.51 E-value=8.5e-15 Score=105.84 Aligned_cols=46 Identities=76% Similarity=1.173 Sum_probs=41.6
Q ss_pred cccCCCCCcccccc-CCCCCccccccccccccceeEEEeccCCCCCC
Q 021515 238 KRKCNSMDDAALKC-GSSSGRCHCSKKRKSRIKRVTRVPAISSKMAD 283 (311)
Q Consensus 238 krkC~~~~~~~~~~-~~~~~~~~~~Krrk~~~kr~vrvp~~s~~~~~ 283 (311)
||+|+++++.+++| .+++|+|||+||||+|+||+||||+|+++++|
T Consensus 1 krkC~~~~~~~~~~~~sssgrCHCsKkRK~RvKR~irVPAiS~K~AD 47 (47)
T PF10533_consen 1 KRKCHSHNDSSGKCKCSSSGRCHCSKKRKSRVKRTIRVPAISSKIAD 47 (47)
T ss_pred CCcccccCcccCccccCCCCcccCCCcccccceeeEEeecccccccC
Confidence 68999998888887 57789999999999999999999999988765
No 2
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=99.29 E-value=9.8e-13 Score=99.23 Aligned_cols=25 Identities=68% Similarity=1.283 Sum_probs=23.7
Q ss_pred CCCCchhhhcCCccCCCCCCCC----CCC
Q 021515 285 PPDDYSWRKYGQKPIKGSPHPR----CAS 309 (311)
Q Consensus 285 ~~Dgy~WRKYGQK~Ikgs~~PR----Cs~ 309 (311)
++|||.|||||||.|+|++||| |++
T Consensus 1 ~~DGy~WRKYGQK~ikgs~~pRsYYrCt~ 29 (59)
T smart00774 1 LDDGYQWRKYGQKVIKGSPFPRSYYRCTY 29 (59)
T ss_pred CCCcccccccCcEecCCCcCcceEEeccc
Confidence 4899999999999999999999 987
No 3
>PF03106 WRKY: WRKY DNA -binding domain; InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=99.28 E-value=3.1e-13 Score=101.77 Aligned_cols=26 Identities=65% Similarity=1.212 Sum_probs=21.8
Q ss_pred CCCCchhhhcCCccCCCCCCCC----CCCC
Q 021515 285 PPDDYSWRKYGQKPIKGSPHPR----CASV 310 (311)
Q Consensus 285 ~~Dgy~WRKYGQK~Ikgs~~PR----Cs~~ 310 (311)
++|||.|||||||.|+|++||| |+..
T Consensus 1 ~~Dgy~WRKYGqK~i~g~~~pRsYYrCt~~ 30 (60)
T PF03106_consen 1 LDDGYRWRKYGQKNIKGSPYPRSYYRCTHP 30 (60)
T ss_dssp --SSS-EEEEEEEEETTTTCEEEEEEEECT
T ss_pred CCCCCchhhccCcccCCCceeeEeeecccc
Confidence 4899999999999999999999 8864
No 4
>PF05344 DUF746: Domain of Unknown Function (DUF746); InterPro: IPR008008 This is a short conserved region found in some transposons.
Probab=90.59 E-value=0.43 Score=37.26 Aligned_cols=57 Identities=25% Similarity=0.222 Sum_probs=38.6
Q ss_pred HHHHHHHHhccCCCCCccccccccccCCCCCCCCCCchhHHHHHHHHHhhhhhhhhccCCCCCCc--cccccCCCC
Q 021515 36 SIGEFIKLLSRSGQVPSEQQTQYQESTSSSPTNLEPDKEIKVAAEVAVNNFKKVISLLGRPRTGH--ARFRRAPVG 109 (311)
Q Consensus 36 S~e~Li~lLSq~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~itd~AVsKFKKVISLL~rtRTGH--ARFRR~Pv~ 109 (311)
.+++||++||++-. ..+ .. .....| ..++..-|..|++-+=.|| ++|| +|+|-|=.+
T Consensus 2 ~~~~fIrlLs~~~s---~~~--Aa---------~~lG~~-~~~v~~wv~~fR~wll~LD--PSG~~E~RVRLg~r~ 60 (65)
T PF05344_consen 2 KARAFIRLLSQQIS---VAQ--AA---------DRLGTD-PGTVRRWVRMFRQWLLQLD--PSGHWEARVRLGVRP 60 (65)
T ss_pred cHHHHHHHhccccc---HHH--HH---------HHHCcC-HHHHHHHHHHHHHHHHHcC--CCCChHHHhhcCCCC
Confidence 47899999998722 001 00 011222 3455678999999999999 8999 999977643
No 5
>PF03859 CG-1: CG-1 domain; InterPro: IPR005559 CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein []. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin-binding domain and ankyrins [].; GO: 0005516 calmodulin binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=30.59 E-value=16 Score=31.64 Aligned_cols=9 Identities=44% Similarity=0.892 Sum_probs=7.6
Q ss_pred CCCCchhhh
Q 021515 285 PPDDYSWRK 293 (311)
Q Consensus 285 ~~Dgy~WRK 293 (311)
-.|||.|||
T Consensus 51 RkDG~~WrK 59 (118)
T PF03859_consen 51 RKDGHNWRK 59 (118)
T ss_pred hcccceeEE
Confidence 379999987
No 6
>PF07516 SecA_SW: SecA Wing and Scaffold domain; InterPro: IPR011116 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane. SecA protein achieves this translocation, in association with SecY protein, in an ATP-dependent manner. This domain is composed of two C-terminal alpha helical subdomains: the wing and scaffold subdomains.; GO: 0017038 protein import, 0016020 membrane; PDB: 1NL3_B 1NKT_B 2FSG_B 2VDA_A 2FSH_A 2FSF_A 2FSI_A 2IPC_D 3JUX_A 3DIN_B ....
Probab=17.92 E-value=46 Score=30.07 Aligned_cols=6 Identities=67% Similarity=1.177 Sum_probs=2.2
Q ss_pred hhhcCC
Q 021515 291 WRKYGQ 296 (311)
Q Consensus 291 WRKYGQ 296 (311)
||-|||
T Consensus 174 lR~y~Q 179 (214)
T PF07516_consen 174 LRSYGQ 179 (214)
T ss_dssp CTTSSS
T ss_pred HHhHcc
Confidence 333333
No 7
>PF08257 Sulfakinin: Sulfakinin family; InterPro: IPR013259 The sulfakinin (SK) family of neuropeptides have only been identified in crustaceans and insects. For most species there is the potential for producing two sulfakinin peptides, one has a short sulfakinin sequence. The function of the sulfakinins is difficult to assess. For the Periplaneta americana (American cockroach), various forms of the endogenous sulfakinins have been shown to be active on the hindgut, and also on the heart. In Calliphora vomitoria (Blue blowfly) the peptides act as neurotransmitters or neuromodulators, linking the brain with all thoracic and abdominal ganglia. In adults of Penaeus monodon (Penoeid shrimp) they appear to be restricted to a few neurones in the brain with a neural pathway extending along to the ventral thoracic and abdominal ganglia [].
Probab=17.84 E-value=49 Score=16.92 Aligned_cols=7 Identities=57% Similarity=1.018 Sum_probs=5.3
Q ss_pred CCCcccc
Q 021515 97 RTGHARF 103 (311)
Q Consensus 97 RTGHARF 103 (311)
--||-||
T Consensus 3 dyghmrf 9 (9)
T PF08257_consen 3 DYGHMRF 9 (9)
T ss_pred ccccccC
Confidence 3589887
No 8
>PF11946 DUF3463: Domain of unknown function (DUF3463); InterPro: IPR022563 This functionally uncharacterised domain is found in bacteria and archaea, which is about 140 amino acids in length and is found C-terminal to PF04055 from PFAM. It contains two conserved sequence motifs: CTPWG and PCYL. This domain is associated with hopanoid biosynthesis associated radical SAM proteins.
Probab=16.49 E-value=61 Score=28.81 Aligned_cols=17 Identities=47% Similarity=1.103 Sum_probs=12.6
Q ss_pred CCchhhhcCCccCCCCCCCCCC
Q 021515 287 DDYSWRKYGQKPIKGSPHPRCA 308 (311)
Q Consensus 287 Dgy~WRKYGQK~Ikgs~~PRCs 308 (311)
+.+.|.||| -..+|||-
T Consensus 93 e~t~We~Yg-----~g~~prC~ 109 (138)
T PF11946_consen 93 ETTDWEKYG-----VGRDPRCA 109 (138)
T ss_pred HCCChHhhC-----CCCCCCHH
Confidence 445799999 56788853
No 9
>COG4283 Uncharacterized conserved protein [Function unknown]
Probab=14.90 E-value=66 Score=29.49 Aligned_cols=12 Identities=33% Similarity=1.016 Sum_probs=7.3
Q ss_pred CCCCCchhhhcC
Q 021515 284 IPPDDYSWRKYG 295 (311)
Q Consensus 284 ~~~Dgy~WRKYG 295 (311)
+|.+||.|+-||
T Consensus 75 ~Ps~~ykWn~~g 86 (170)
T COG4283 75 TPSPGYKWNNLG 86 (170)
T ss_pred CCCCCCcccccH
Confidence 456666666665
No 10
>KOG0673 consensus Thymidylate synthase [Nucleotide transport and metabolism]
Probab=13.72 E-value=64 Score=31.48 Aligned_cols=23 Identities=35% Similarity=0.833 Sum_probs=18.8
Q ss_pred CCCCCchhhhcCCc---------------------cCCCCCCCC
Q 021515 284 IPPDDYSWRKYGQK---------------------PIKGSPHPR 306 (311)
Q Consensus 284 ~~~Dgy~WRKYGQK---------------------~Ikgs~~PR 306 (311)
.|--|+.||-+|-| .||.+|+-|
T Consensus 112 gpvyGfqWrHfgA~Y~~~~~dy~gqgvdQL~~vI~~ik~NP~dr 155 (293)
T KOG0673|consen 112 GPVYGFQWRHFGARYEDCDSDYTGQGVDQLADVINKIKNNPDDR 155 (293)
T ss_pred ccccceeeeecCccccccccccccccHHHHHHHHHHHhcCCccc
Confidence 46689999999988 578888877
Done!