Citrus Sinensis ID: 021516
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 311 | ||||||
| 255537131 | 442 | amino acid binding protein, putative [Ri | 0.893 | 0.628 | 0.898 | 1e-150 | |
| 224074729 | 442 | predicted protein [Populus trichocarpa] | 0.890 | 0.626 | 0.874 | 1e-146 | |
| 225426651 | 444 | PREDICTED: uncharacterized protein LOC10 | 0.916 | 0.641 | 0.860 | 1e-144 | |
| 297742666 | 440 | unnamed protein product [Vitis vinifera] | 0.916 | 0.647 | 0.860 | 1e-144 | |
| 224124920 | 442 | predicted protein [Populus trichocarpa] | 0.897 | 0.631 | 0.867 | 1e-143 | |
| 356540171 | 441 | PREDICTED: Protein-PII uridylyltransfera | 0.887 | 0.625 | 0.821 | 1e-139 | |
| 356497179 | 441 | PREDICTED: uncharacterized protein LOC10 | 0.887 | 0.625 | 0.811 | 1e-136 | |
| 449528978 | 450 | PREDICTED: uncharacterized LOC101205369 | 0.919 | 0.635 | 0.836 | 1e-134 | |
| 449460443 | 449 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.919 | 0.636 | 0.836 | 1e-134 | |
| 449459664 | 448 | PREDICTED: uncharacterized protein LOC10 | 0.897 | 0.622 | 0.795 | 1e-132 |
| >gi|255537131|ref|XP_002509632.1| amino acid binding protein, putative [Ricinus communis] gi|223549531|gb|EEF51019.1| amino acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 536 bits (1381), Expect = e-150, Method: Compositional matrix adjust.
Identities = 257/286 (89%), Positives = 269/286 (94%)
Query: 4 MEWPACLDEYEKLVIRMNTPRVVIDNAVCPTATLVKVDSARRHGILLEAVQVLTDLNLLI 63
MEW A LDEYEKLVIRM TPRVVIDN VCPTAT+VKVDSAR+HGILLEAVQVLTDLNL I
Sbjct: 1 MEWSAYLDEYEKLVIRMTTPRVVIDNGVCPTATVVKVDSARKHGILLEAVQVLTDLNLSI 60
Query: 64 KKAYISSDGRFFMDVFHVTDLNGNKLTDESVISYIEQSLETIHYGRSNSFNGLTALELTG 123
KKAYISSDGR+FMDVFHVTD+NGNKLTDESVI+YIEQSL TIHYGR++ FNGLTALELTG
Sbjct: 61 KKAYISSDGRWFMDVFHVTDINGNKLTDESVINYIEQSLGTIHYGRTHDFNGLTALELTG 120
Query: 124 TDRVGLLSEVFAVLADLQCSVVEAKVWTHNGRIASLIYVKDCNSGSPIEDSQQIDRIEAR 183
TDRVGLLSEVFAVLADLQC VVEAKVWTHNGRIASLIYVKDCNSGSPIEDSQ IDRIEAR
Sbjct: 121 TDRVGLLSEVFAVLADLQCDVVEAKVWTHNGRIASLIYVKDCNSGSPIEDSQHIDRIEAR 180
Query: 184 LRNVLKGDNDIRSAKMTVSMAVTHTERRLHQMMFADRDYERMPVLRHSTDYPVVTVQNWA 243
LRNVLKGDNDIRSAK +VSMAVTHTERRLHQMMFADRDYER P+LR S D PVVTVQNW
Sbjct: 181 LRNVLKGDNDIRSAKTSVSMAVTHTERRLHQMMFADRDYERKPILRFSADSPVVTVQNWV 240
Query: 244 DRSYSVVNVQCKDRTKLLFDVVCTLTDMEYVVFHATINTAGERAYL 289
+R YSVVNVQCKDR KLLFDVVCTLTDMEYVVFHATINTAG++AYL
Sbjct: 241 ERGYSVVNVQCKDRMKLLFDVVCTLTDMEYVVFHATINTAGDKAYL 286
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224074729|ref|XP_002304443.1| predicted protein [Populus trichocarpa] gi|222841875|gb|EEE79422.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225426651|ref|XP_002281251.1| PREDICTED: uncharacterized protein LOC100242743 [Vitis vinifera] gi|147794108|emb|CAN62364.1| hypothetical protein VITISV_031924 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297742666|emb|CBI34815.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224124920|ref|XP_002329846.1| predicted protein [Populus trichocarpa] gi|222871083|gb|EEF08214.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356540171|ref|XP_003538563.1| PREDICTED: Protein-PII uridylyltransferase [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356497179|ref|XP_003517440.1| PREDICTED: uncharacterized protein LOC100780903 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449528978|ref|XP_004171478.1| PREDICTED: uncharacterized LOC101205369 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449460443|ref|XP_004147955.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101205369 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449459664|ref|XP_004147566.1| PREDICTED: uncharacterized protein LOC101209959 [Cucumis sativus] gi|449520363|ref|XP_004167203.1| PREDICTED: uncharacterized LOC101209959 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 311 | ||||||
| TAIR|locus:2034630 | 441 | ACR8 "AT1G12420" [Arabidopsis | 0.900 | 0.634 | 0.726 | 2.1e-107 | |
| TAIR|locus:2132609 | 449 | ACR7 "ACT domain repeat 7" [Ar | 0.909 | 0.630 | 0.674 | 1.3e-98 | |
| TAIR|locus:2033223 | 455 | ACR4 "ACT domain repeat 4" [Ar | 0.893 | 0.610 | 0.558 | 3.4e-77 | |
| TAIR|locus:2078678 | 433 | ACR6 "ACT domain repeat 6" [Ar | 0.890 | 0.639 | 0.522 | 1.8e-69 | |
| TAIR|locus:2044289 | 456 | ACR5 "ACT domain repeat 5" [Ar | 0.684 | 0.467 | 0.543 | 3.3e-57 | |
| TAIR|locus:2145482 | 500 | AT5G25320 [Arabidopsis thalian | 0.668 | 0.416 | 0.434 | 6.9e-57 | |
| TAIR|locus:2025317 | 453 | ACR3 "ACT domain repeat 3" [Ar | 0.742 | 0.509 | 0.502 | 7.8e-56 | |
| TAIR|locus:2152094 | 477 | ACR1 "ACT domain repeat 1" [Ar | 0.659 | 0.429 | 0.438 | 3.4e-38 | |
| TAIR|locus:2039782 | 411 | ACR9 "ACT domain repeats 9" [A | 0.800 | 0.605 | 0.224 | 2.8e-08 | |
| TAIR|locus:2175458 | 301 | ACR12 "ACT domain repeats 12" | 0.257 | 0.265 | 0.296 | 7.2e-05 |
| TAIR|locus:2034630 ACR8 "AT1G12420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1062 (378.9 bits), Expect = 2.1e-107, P = 2.1e-107
Identities = 205/282 (72%), Positives = 241/282 (85%)
Query: 10 LDEYEKLVIRMNTPRVVIDNAVCPTATLVKVDSARRHGILLEAVQVLTDLNLLIKKAYIS 69
LDEYEKLVIRMNTPRVVIDN VC +AT+VKVDS+RR+GILLEAVQ+LTDLNL IKKAYIS
Sbjct: 7 LDEYEKLVIRMNTPRVVIDNGVCSSATIVKVDSSRRNGILLEAVQILTDLNLSIKKAYIS 66
Query: 70 SDGRFFMDVFHVTDLNGNKLTDESVISYIEQSLETIHYGRSNSFNGLTALELTGTDRVGL 129
SDG + MDVFHVTDLNGNKL D+SV+ YIEQS+ET++YG + NGLTALELTGTDR+GL
Sbjct: 67 SDGTWNMDVFHVTDLNGNKLNDQSVLRYIEQSIETVYYGENIEVNGLTALELTGTDRIGL 126
Query: 130 LSEVFAVLADLQCSVVEAKVWTHNGRIASLIYVKDCNSGSPIEDSQQIDRIEARLRNVLK 189
LSE+FAVL+DL C VV+AK+WTHNGR+AS+IY+KDC SG+PI DS +I +IE RL+NVL
Sbjct: 127 LSEMFAVLSDLNCDVVDAKLWTHNGRVASVIYLKDCISGAPILDSHRISKIEGRLKNVLN 186
Query: 190 GDNDIRSAKMT-VSM-AVTHTERRLHQMMFADRDYERMPVLRHSTDYPVVTVQNWADRSY 247
GDND+ SA T V++ ++ H ERRLHQ+MF DRDYER + VVTVQNWA+R Y
Sbjct: 187 GDNDVNSAAKTCVTVDSMMHIERRLHQLMFEDRDYERRSKKHERSPMVVVTVQNWAERGY 246
Query: 248 SVVNVQCKDRTKLLFDVVCTLTDMEYVVFHATINTAGERAYL 289
SVVNV C+DRTKLLFDVVCTLTDMEY VFHATINTA ++A+L
Sbjct: 247 SVVNVHCRDRTKLLFDVVCTLTDMEYAVFHATINTAEDQAHL 288
|
|
| TAIR|locus:2132609 ACR7 "ACT domain repeat 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033223 ACR4 "ACT domain repeat 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078678 ACR6 "ACT domain repeat 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044289 ACR5 "ACT domain repeat 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145482 AT5G25320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025317 ACR3 "ACT domain repeat 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152094 ACR1 "ACT domain repeat 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039782 ACR9 "ACT domain repeats 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175458 ACR12 "ACT domain repeats 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 311 | |||
| cd04895 | 72 | cd04895, ACT_ACR_1, ACT domain-containing protein | 1e-38 | |
| cd04925 | 74 | cd04925, ACT_ACR_2, ACT domain-containing protein | 2e-35 | |
| cd04897 | 75 | cd04897, ACT_ACR_3, ACT domain-containing protein | 2e-20 | |
| cd04899 | 70 | cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain | 6e-20 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 1e-14 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 1e-13 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 2e-10 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 2e-10 | |
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 3e-10 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 3e-09 | |
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 6e-08 | |
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 9e-07 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 1e-06 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 1e-06 | |
| PRK03381 | 774 | PRK03381, PRK03381, PII uridylyl-transferase; Prov | 2e-06 | |
| cd04899 | 70 | cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain | 3e-06 | |
| PRK00275 | 895 | PRK00275, glnD, PII uridylyl-transferase; Provisio | 6e-06 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 7e-06 | |
| PRK00275 | 895 | PRK00275, glnD, PII uridylyl-transferase; Provisio | 7e-06 | |
| cd02116 | 60 | cd02116, ACT, ACT domains are commonly involved in | 1e-05 | |
| pfam01842 | 66 | pfam01842, ACT, ACT domain | 2e-05 | |
| cd04926 | 72 | cd04926, ACT_ACR_4, C-terminal ACT domain, of a no | 3e-05 | |
| cd04900 | 73 | cd04900, ACT_UUR-like_1, ACT domain family, ACT_UU | 5e-05 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 9e-05 | |
| cd04926 | 72 | cd04926, ACT_ACR_4, C-terminal ACT domain, of a no | 1e-04 | |
| cd04900 | 73 | cd04900, ACT_UUR-like_1, ACT domain family, ACT_UU | 2e-04 | |
| PRK00275 | 895 | PRK00275, glnD, PII uridylyl-transferase; Provisio | 4e-04 | |
| cd04876 | 71 | cd04876, ACT_RelA-SpoT, ACT domain found C-termina | 0.001 | |
| cd04899 | 70 | cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain | 0.002 | |
| PRK03381 | 774 | PRK03381, PRK03381, PII uridylyl-transferase; Prov | 0.003 | |
| PRK01759 | 854 | PRK01759, glnD, PII uridylyl-transferase; Provisio | 0.003 | |
| pfam13291 | 77 | pfam13291, ACT_4, ACT domain | 0.004 | |
| cd04927 | 76 | cd04927, ACT_ACR-like_2, Second ACT domain, of a n | 0.004 |
| >gnl|CDD|153167 cd04895, ACT_ACR_1, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
Score = 131 bits (330), Expect = 1e-38
Identities = 55/72 (76%), Positives = 62/72 (86%)
Query: 35 ATLVKVDSARRHGILLEAVQVLTDLNLLIKKAYISSDGRFFMDVFHVTDLNGNKLTDESV 94
TLVKVDSAR+ GILLEAVQVLTDL+L I KAYISSDG +FMDVFHVTD GNKLTD+S+
Sbjct: 1 CTLVKVDSARKPGILLEAVQVLTDLDLCITKAYISSDGGWFMDVFHVTDQLGNKLTDDSL 60
Query: 95 ISYIEQSLETIH 106
I+YIE+SL T
Sbjct: 61 IAYIEKSLGTSR 72
|
This CD includes the N-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 72 |
| >gnl|CDD|153197 cd04925, ACT_ACR_2, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153169 cd04897, ACT_ACR_3, ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|190133 pfam01842, ACT, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153172 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153172 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153148 cd04876, ACT_RelA-SpoT, ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234980 PRK01759, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222030 pfam13291, ACT_4, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|153199 cd04927, ACT_ACR-like_2, Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 311 | |||
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 99.97 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 99.97 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 99.96 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 99.96 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.96 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.95 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.95 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.95 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.94 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.94 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.94 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.94 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.94 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.94 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.94 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.94 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.94 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.93 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.82 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.81 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.78 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.76 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.76 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.71 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.68 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.66 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.62 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.62 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.59 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.59 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 99.59 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.56 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.52 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 99.45 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 99.45 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 99.39 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 99.38 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.37 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.35 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 99.33 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.28 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.18 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 98.96 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 98.86 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.86 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.65 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 98.63 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.62 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 98.58 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.57 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.55 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.51 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.49 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.41 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 98.28 | |
| PRK00194 | 90 | hypothetical protein; Validated | 98.19 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 98.18 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 98.16 | |
| PRK00194 | 90 | hypothetical protein; Validated | 98.14 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 98.13 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 98.12 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 98.1 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.82 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.81 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.81 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.8 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 97.79 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.73 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 97.71 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.7 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.63 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.62 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.58 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.53 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.52 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.5 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.47 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 97.47 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.38 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.36 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 97.36 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 97.27 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 97.26 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 97.25 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 97.22 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 97.19 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 97.18 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 97.17 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 97.13 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 97.12 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 97.07 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 97.06 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 97.03 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 97.03 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 97.01 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.01 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 96.95 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 96.93 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 96.9 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 96.86 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 96.84 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 96.81 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 96.81 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 96.8 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 96.79 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 96.72 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 96.71 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 96.69 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 96.67 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.67 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 96.65 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 96.65 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 96.63 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 96.59 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 96.57 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 96.53 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 96.5 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.49 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 96.43 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 96.43 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 96.37 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 96.34 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 96.34 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 96.3 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 96.3 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 96.29 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 96.29 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 96.29 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 96.28 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 96.25 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 96.21 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 96.18 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 96.15 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 96.13 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 96.1 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 95.98 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 95.98 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 95.97 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 95.92 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 95.9 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 95.88 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 95.84 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 95.77 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 95.54 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 95.51 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 95.49 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 95.36 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 95.22 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 95.05 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 94.84 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 94.81 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 94.73 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 94.71 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 94.59 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 94.52 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 94.42 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 94.41 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 94.31 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 94.31 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 94.23 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 94.04 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 93.68 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 93.68 | |
| PLN02551 | 521 | aspartokinase | 93.64 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 93.62 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 93.6 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 93.58 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 93.46 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 93.38 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 93.35 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 93.31 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 93.28 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 93.25 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 93.09 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 92.95 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 92.94 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 92.79 | |
| PRK09181 | 475 | aspartate kinase; Validated | 92.7 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 92.62 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 92.55 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 92.32 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 92.22 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 92.17 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 91.93 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 91.84 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 91.79 | |
| PRK12483 | 521 | threonine dehydratase; Reviewed | 91.62 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 91.51 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 91.45 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 91.35 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 91.34 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 91.2 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 90.49 | |
| KOG2663 | 309 | consensus Acetolactate synthase, small subunit [Am | 90.42 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 90.42 | |
| PRK09224 | 504 | threonine dehydratase; Reviewed | 90.33 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 90.08 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 89.94 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 89.87 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 89.62 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 89.5 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 88.99 | |
| KOG2663 | 309 | consensus Acetolactate synthase, small subunit [Am | 88.85 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 88.73 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 88.7 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 88.43 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 88.17 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 87.87 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 87.85 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 87.46 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 87.42 | |
| cd04913 | 75 | ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- | 87.38 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 86.97 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 86.4 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 86.38 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 86.32 | |
| PRK08961 | 861 | bifunctional aspartate kinase/diaminopimelate deca | 86.02 | |
| PF05088 | 1528 | Bac_GDH: Bacterial NAD-glutamate dehydrogenase | 85.92 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 85.68 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 85.62 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 85.35 | |
| PLN02551 | 521 | aspartokinase | 84.13 | |
| PRK08526 | 403 | threonine dehydratase; Provisional | 84.1 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 83.55 | |
| cd04937 | 64 | ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela | 82.93 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 82.56 | |
| cd04891 | 61 | ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- | 82.14 | |
| COG2150 | 167 | Predicted regulator of amino acid metabolism, cont | 81.72 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 81.43 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 81.28 | |
| TIGR01270 | 464 | Trp_5_monoox tryptophan 5-monooxygenase, tetrameri | 80.84 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 80.8 | |
| PRK09181 | 475 | aspartate kinase; Validated | 80.76 | |
| cd04919 | 66 | ACT_AK-Hom3_2 ACT domains located C-terminal to th | 80.58 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 80.51 | |
| cd04913 | 75 | ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- | 80.17 | |
| COG3978 | 86 | Acetolactate synthase (isozyme II), small (regulat | 80.1 |
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
Probab=99.97 E-value=9.7e-31 Score=271.97 Aligned_cols=166 Identities=17% Similarity=0.222 Sum_probs=144.5
Q ss_pred CCCCCeEEEEEEeCCcccHHHHHHHHHHhCCCeEEEEEEEc-cCceEEEEEEEEecCCCCCCCChHHHHHHHHHHHHHhc
Q 021516 111 NSFNGLTALELTGTDRVGLLSEVFAVLADLQCSVVEAKVWT-HNGRIASLIYVKDCNSGSPIEDSQQIDRIEARLRNVLK 189 (311)
Q Consensus 111 ~~~~~~t~i~V~~~DrpGLL~~I~~~L~~~glnI~~A~i~T-~~~~~~d~F~V~~~~~g~~~~~~~~~~~l~~~L~~~L~ 189 (311)
+.+.+.++|+|+++||||||++|+++|+.+|+||++|+|+| .+|++.|+|+|.+ .+|.++. +++++.|++.|.++|.
T Consensus 672 ~~~~~~t~V~V~~~DrpGLfa~Ia~~L~~~~L~I~~A~I~T~~~g~alD~F~V~d-~~g~~~~-~~~~~~l~~~L~~aL~ 749 (854)
T PRK01759 672 RFSRGGTEIFIYCQDQANLFLKVVSTIGAKKLSIHDAQIITSQDGYVLDSFIVTE-LNGKLLE-FDRRRQLEQALTKALN 749 (854)
T ss_pred cCCCCeEEEEEEecCCccHHHHHHHHHHHCCCeEEEEEEEEccCCEEEEEEEEeC-CCCCCCC-HHHHHHHHHHHHHHHc
Confidence 55678999999999999999999999999999999999998 6899999999999 6888885 5788999999999998
Q ss_pred CCCCcchhhhhhhhccccchhhhhhhhhcccccccccccCCCCCCCEEEEEcCCCCceeEEEEEeCCccchHHHHHHHhh
Q 021516 190 GDNDIRSAKMTVSMAVTHTERRLHQMMFADRDYERMPVLRHSTDYPVVTVQNWADRSYSVVNVQCKDRTKLLFDVVCTLT 269 (311)
Q Consensus 190 ~~~~~~~~~~~l~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~V~id~~~s~~~tvl~v~~~DRpGLL~~I~~~l~ 269 (311)
+...+. . .. ++.++. +.| ..|++|.|||+.|..+|+|+|.|+|||||||+|+++|.
T Consensus 750 ~~~~~~---~-------~~-~~~~~~----~~~---------~~~~~V~~dn~~s~~~T~iev~a~DrpGLL~~I~~~l~ 805 (854)
T PRK01759 750 TNKLKK---L-------NL-EENHKL----QHF---------HVKTEVRFLNEEKQEQTEMELFALDRAGLLAQVSQVFS 805 (854)
T ss_pred CCCCcc---h-------hc-cccccc----cCC---------CCCCEEEEccCCCCCeEEEEEEeCCchHHHHHHHHHHH
Confidence 754321 0 00 011110 223 68999999999999999999999999999999999999
Q ss_pred cCCeEEEEEEEEecCCeEEEEEEEEecCCCeeE
Q 021516 270 DMEYVVFHATINTAGERAYLVINCYQFDSNYCC 302 (311)
Q Consensus 270 ~~gi~I~~A~I~T~g~~a~D~F~v~~~~g~~~~ 302 (311)
++|++|++|||+|.|++|+|+|||++.+|+++.
T Consensus 806 ~~~l~i~~AkI~T~gerv~D~Fyv~~~~g~~l~ 838 (854)
T PRK01759 806 ELNLNLLNAKITTIGEKAEDFFILTNQQGQALD 838 (854)
T ss_pred HCCCEEEEEEEcccCceEEEEEEEECCCCCcCC
Confidence 999999999999999999999999999999765
|
|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12483 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >PRK09224 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional | Back alignment and domain information |
|---|
| >PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PRK08526 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins | Back alignment and domain information |
|---|
| >COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins | Back alignment and domain information |
|---|
| >COG3978 Acetolactate synthase (isozyme II), small (regulatory) subunit [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 311 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-05 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 8e-05 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 52.9 bits (126), Expect = 6e-08
Identities = 50/322 (15%), Positives = 97/322 (30%), Gaps = 83/322 (25%)
Query: 11 DEYEKLVIRMNTPRVVIDNAVCPTATLVKVDSARRHGILLEAVQVLTDLNLLIKKAYISS 70
+ E ++ + ID + D + + + ++Q LL K Y +
Sbjct: 193 NSPETVLEMLQKLLYQIDPNWTS-----RSDHSSNIKLRIHSIQ-AELRRLLKSKPYENC 246
Query: 71 ----DGRFFMDVFHVTDLN----GNK--LT--DESVISYIEQSLETIHYGRSNSFNGLTA 118
+V + N K LT + V ++ + T H + LT
Sbjct: 247 LLVLL-----NVQNAKAWNAFNLSCKILLTTRFKQVTDFL-SAATTTHISLDHHSMTLTP 300
Query: 119 LELTGTDRVGLLSEVFAVLADLQCSVVEAKVWTHNGRIASLIYVKDCNSGSPIEDSQQID 178
E+ LL + Q E T N R S+I I D +
Sbjct: 301 DEV-----KSLLLKYLDC--RPQDLPREVL--TTNPRRLSII-------AESIRD--GLA 342
Query: 179 RIEARLRNVLKGDNDIRSAKMTVSMAVTHTERRLHQMMFADRDYERMPVLRHSTDYPVVT 238
+ ++V + + ++ E ++ M ++R+ V S P +
Sbjct: 343 TWD-NWKHV-----NCDKLTTIIESSLNVLEPAEYRKM-----FDRLSVFPPSAHIPTIL 391
Query: 239 VQN-WAD-------------RSYSVVNVQCKDRTK----LLFDVVCTLTDMEYVVFHATI 280
+ W D YS+V Q K+ T + ++ L + + H +I
Sbjct: 392 LSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYAL--HRSI 449
Query: 281 NTAGERAYLVINCYQFDSNYCC 302
++ Y +
Sbjct: 450 ----------VDHYNIPKTFDS 461
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 311 | |||
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.79 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.77 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.75 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.73 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.95 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.86 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 98.76 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 98.41 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.34 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.26 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 98.03 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 98.03 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 97.91 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 97.7 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.65 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 97.64 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 97.6 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 97.58 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 97.54 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 97.54 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 97.54 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.51 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 97.5 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 97.5 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 97.49 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 97.47 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 97.47 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 97.46 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 97.33 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 97.23 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 97.16 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 97.14 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 97.08 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 96.73 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 96.7 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 96.67 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 96.62 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 96.6 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 96.55 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 96.47 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 96.23 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 96.05 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 96.01 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 95.9 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 95.83 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 95.49 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 95.34 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 93.75 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 93.38 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 93.25 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 92.7 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 92.18 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 91.21 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 90.71 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 90.46 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 89.42 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 89.41 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 89.26 | |
| 3luy_A | 329 | Probable chorismate mutase; structural genomics, A | 88.53 | |
| 3mwb_A | 313 | Prephenate dehydratase; L-Phe, PSI, MCSG, structur | 87.57 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 86.9 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 86.43 | |
| 2qmw_A | 267 | PDT, prephenate dehydratase; APC85812, prephenate | 86.01 | |
| 3luy_A | 329 | Probable chorismate mutase; structural genomics, A | 84.85 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 84.67 | |
| 3mwb_A | 313 | Prephenate dehydratase; L-Phe, PSI, MCSG, structur | 82.42 | |
| 2qmw_A | 267 | PDT, prephenate dehydratase; APC85812, prephenate | 82.19 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 80.84 |
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
Probab=99.79 E-value=3.3e-18 Score=148.28 Aligned_cols=148 Identities=19% Similarity=0.161 Sum_probs=110.8
Q ss_pred CeEEEEEEecCCCcHHHHHHHHHHhCCceEEEEEEEEcCCEEEEEEEEEeCCCCCCCcHHHHHHHHHHhhhccC------
Q 021516 34 TATLVKVDSARRHGILLEAVQVLTDLNLLIKKAYISSDGRFFMDVFHVTDLNGNKLTDESVISYIEQSLETIHY------ 107 (311)
Q Consensus 34 ~~t~V~V~~~DrpGL~~~i~~~L~~~glnI~~A~i~t~~g~~~d~f~v~~~~g~~~~~~~~~~~l~~~L~~~~~------ 107 (311)
...+|+|+|+||||||++++++|+.+|+||++|++++..|.+.-.|.|..+. . ......+.|++.|.....
T Consensus 4 ~~~~ltv~~~DrpGiva~vs~~La~~g~NI~da~q~~~~~~f~m~~~v~~~~-~--~~~~~~~~l~~~L~~~~~~~~~~~ 80 (195)
T 2nyi_A 4 QSFVVSVAGSDRVGIVHDFSWALKNISANVESSRMACLGGDFAMIVLVSLNA-K--DGKLIQSALESALPGFQISTRRAS 80 (195)
T ss_dssp EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEESS-S--SSHHHHHHHHHHSTTCEEEEEECC
T ss_pred eEEEEEEEeCCCCcHHHHHHHHHHHCCCCEEEEEeEEECCeEEEEEEEEecC-c--cchhHHHHHHHHHHHHHHhcCCeE
Confidence 3578999999999999999999999999999999998555444478886542 1 212345667777754321
Q ss_pred -CCC---CCCCCeEEEEEEeCCcccHHHHHHHHHHhCCCeEEEEEEEccC--ceEEEEEEEEecCCCCCCCChHHHHHHH
Q 021516 108 -GRS---NSFNGLTALELTGTDRVGLLSEVFAVLADLQCSVVEAKVWTHN--GRIASLIYVKDCNSGSPIEDSQQIDRIE 181 (311)
Q Consensus 108 -rr~---~~~~~~t~i~V~~~DrpGLL~~I~~~L~~~glnI~~A~i~T~~--~~~~d~F~V~~~~~g~~~~~~~~~~~l~ 181 (311)
.++ ......++|+|.|+||||++++|+++|+++|+||.++++.|.+ ++..+.|++.. ..+.+ +... +.|+
T Consensus 81 ~~~~~~~~~~~~~~iltv~g~DrpGiva~Vt~~La~~g~nI~~~~~~t~~~~~~~~~~F~m~~-~~~~~--~~~~-~~l~ 156 (195)
T 2nyi_A 81 SVAERHVSPDTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGFTLFRMGS-RVAFP--FPLY-QEVV 156 (195)
T ss_dssp CC----CCTTEEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEEECSSTTCEEEEEEE-EEEEE--GGGH-HHHH
T ss_pred EEEeCCcCCCCcEEEEEEEeCCCcCHHHHHHHHHHHcCCCEEEceeeecccccCCCCeEEEEE-EEEcC--CCcc-HHHH
Confidence 011 2234678999999999999999999999999999999999987 55678888876 33323 2345 7888
Q ss_pred HHHHHHh
Q 021516 182 ARLRNVL 188 (311)
Q Consensus 182 ~~L~~~L 188 (311)
+.|....
T Consensus 157 ~~l~~~a 163 (195)
T 2nyi_A 157 TALSRVE 163 (195)
T ss_dssp HHHHHHH
T ss_pred HHHHHHH
Confidence 8888643
|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 | Back alignment and structure |
|---|
| >3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 311 | ||||
| d1y7pa2 | 77 | d.58.18.12 (A:2-78) Hypothetical protein AF1403, N | 6e-05 | |
| d1u8sa1 | 86 | d.58.18.5 (A:2-87) putative transcriptional repres | 0.001 |
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: AF1403 N-terminal domain-like domain: Hypothetical protein AF1403, N-terminal domain species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Score = 38.6 bits (90), Expect = 6e-05
Identities = 10/75 (13%), Positives = 29/75 (38%), Gaps = 11/75 (14%)
Query: 116 LTALELTGTDRVGLLSEVFAVLADLQCSVVEAKVWTHNGRIASL---IYVKDCNSGSPIE 172
L L + +++G+L ++ ++A+ ++ A+ + IY +
Sbjct: 1 LRGLRIIAENKIGVLRDLTTIIAEEGGNITFAQTFLIKHGEHEGKALIYFEIEGG----- 55
Query: 173 DSQQIDRIEARLRNV 187
++I R++
Sbjct: 56 ---DFEKILERVKTF 67
|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 311 | |||
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.93 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.72 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.68 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.66 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 98.34 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 98.2 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.98 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.86 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.76 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.75 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.71 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.54 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.53 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 97.49 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 97.46 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.44 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.44 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 97.39 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 97.01 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 96.94 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 96.54 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 96.52 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 95.1 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 94.6 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 93.9 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 92.5 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 90.24 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 89.42 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 88.96 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 87.45 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 86.65 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 86.09 | |
| d2cdqa3 | 75 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 80.37 |
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: Glycine cleavage system transcriptional repressor domain: putative transcriptional repressor VC2159 species: Vibrio cholerae [TaxId: 666]
Probab=98.93 E-value=4.6e-09 Score=76.79 Aligned_cols=72 Identities=21% Similarity=0.439 Sum_probs=60.6
Q ss_pred CCCeEEEEEEeCCcccHHHHHHHHHHhCCCeEEEEEEEccCceEEEEEEEEecCCCCCCCChHHHHHHHHHHHHHhcCCC
Q 021516 113 FNGLTALELTGTDRVGLLSEVFAVLADLQCSVVEAKVWTHNGRIASLIYVKDCNSGSPIEDSQQIDRIEARLRNVLKGDN 192 (311)
Q Consensus 113 ~~~~t~i~V~~~DrpGLL~~I~~~L~~~glnI~~A~i~T~~~~~~d~F~V~~~~~g~~~~~~~~~~~l~~~L~~~L~~~~ 192 (311)
..++++|++.|+||||++++++++|+++|+||.+++..+.++.+.-.+.|+. + +..+++|++.|.. |.++.
T Consensus 2 m~~~~vitv~G~DrpGiva~vt~~l~~~g~NI~d~~~~~~~~~~~~~~~v~~-~-------~~~~~~l~~~L~~-l~~~l 72 (86)
T d1u8sa1 2 LTQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISG-S-------PSNITRVETTLPL-LGQQH 72 (86)
T ss_dssp CCEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEE-C-------HHHHHHHHHHHHH-HHHHH
T ss_pred CccEEEEEEEeCCCChHHHHHHHHHHHCCCeEEEeEeEEECCeeEEEEEEEc-C-------cccHHHHHHHHHH-HHHHh
Confidence 4578899999999999999999999999999999999999999988888876 1 3567888888876 44433
Q ss_pred C
Q 021516 193 D 193 (311)
Q Consensus 193 ~ 193 (311)
+
T Consensus 73 ~ 73 (86)
T d1u8sa1 73 D 73 (86)
T ss_dssp T
T ss_pred C
Confidence 3
|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|