BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021521
         (311 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique
           Pyridoxal 5'- Phosphate Dependent Hemeprotein
 pdb|1JBQ|B Chain B, Structure Of Human Cystathionine Beta-Synthase: A Unique
           Pyridoxal 5'- Phosphate Dependent Hemeprotein
 pdb|1JBQ|C Chain C, Structure Of Human Cystathionine Beta-Synthase: A Unique
           Pyridoxal 5'- Phosphate Dependent Hemeprotein
 pdb|1JBQ|D Chain D, Structure Of Human Cystathionine Beta-Synthase: A Unique
           Pyridoxal 5'- Phosphate Dependent Hemeprotein
 pdb|1JBQ|E Chain E, Structure Of Human Cystathionine Beta-Synthase: A Unique
           Pyridoxal 5'- Phosphate Dependent Hemeprotein
 pdb|1JBQ|F Chain F, Structure Of Human Cystathionine Beta-Synthase: A Unique
           Pyridoxal 5'- Phosphate Dependent Hemeprotein
          Length = 435

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 151 LLGVLPKGYEIPSVEALKQDDFTVGRVQFVGFDFLKEVAD 190
           ++GV P+G  +   E L Q + T   V+ +G+DF+  V D
Sbjct: 299 IIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLD 338


>pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols
 pdb|1M54|B Chain B, Cystathionine-Beta Synthase: Reduced Vicinal Thiols
 pdb|1M54|C Chain C, Cystathionine-Beta Synthase: Reduced Vicinal Thiols
 pdb|1M54|D Chain D, Cystathionine-Beta Synthase: Reduced Vicinal Thiols
 pdb|1M54|E Chain E, Cystathionine-Beta Synthase: Reduced Vicinal Thiols
 pdb|1M54|F Chain F, Cystathionine-Beta Synthase: Reduced Vicinal Thiols
          Length = 363

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 151 LLGVLPKGYEIPSVEALKQDDFTVGRVQFVGFDFLKEVAD 190
           ++GV P+G  +   E L Q + T   V+ +G+DF+  V D
Sbjct: 234 IIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLD 273


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.135    0.392 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,648,142
Number of Sequences: 62578
Number of extensions: 328371
Number of successful extensions: 701
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 699
Number of HSP's gapped (non-prelim): 2
length of query: 311
length of database: 14,973,337
effective HSP length: 99
effective length of query: 212
effective length of database: 8,778,115
effective search space: 1860960380
effective search space used: 1860960380
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)