Citrus Sinensis ID: 021523


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MGVKGFVEGGIASIVAGCSTHPLDLIKVRMQLQGENQVPSMRPALAFHANSSAVHVSAPPRLGPVGVGVRIIQQEGVSALFSGVSATVLRQTLYSTTRMGLYDVLKQKWTDPETRNMPLVRKIAAGLIAGGIGAAVGNPADVAMVRMQADGRLPPAQRRNYKSVVDAITSMAKQEGVTSLWRGSSLTVNRAMLVTASQLASYDQIKENILSKGWMRDGLGTHVTASFSAGFVAAVASNPVDVIKTRVMNMKVEAGKEPPYKGALDCALKTVRSEGPMALYKGFIPTISRQGPFTVVLFVTLEQVRKLMKDF
cccHHHHHHHHHHHcHHHHcccHHHHHHHHHHcccccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHc
MGVKGFVEGGIASIVAGCSTHPLDLIKVRMQLQGENQ*******LAFHA***AVHVSAPPRLGPVGVGVRIIQQEGVSALFSGVSATVLRQTLYSTTRMGLYDVLKQKWTDPETRNMPLVRKIAAGLIAGGIGAAVGNPADVAMVRMQADG****AQRRNYKSVVDAITSMAKQEGVTSLWRGSSLTVNRAMLVTASQLASYDQIKENILSKGWMRDGLGTHVTASFSAGFVAAVASNPVDVIKTRVMNMKVEAGKEPPYKGALDCALKTVRSEGPMALYKGFIPTISRQGPFTVVLFVTLEQVRKLMKDF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVKGFVEGGIASIVAGCSTHPLDLIKVRMQLQGENQVPSMRPALAFHANSSAVHVSAPPRLGPVGVGVRIIQQEGVSALFSGVSATVLRQTLYSTTRMGLYDVLKQKWTDPETRNMPLVRKIAAGLIAGGIGAAVGNPADVAMVRMQADGRLPPAQRRNYKSVVDAITSMAKQEGVTSLWRGSSLTVNRAMLVTASQLASYDQIKENILSKGWMRDGLGTHVTASFSAGFVAAVASNPVDVIKTRVMNMKVEAGKEPPYKGALDCALKTVRSEGPMALYKGFIPTISRQGPFTVVLFVTLEQVRKLMKDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial uncoupling protein 5 PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. This leads to a decrease in the efficiency of oxidative phosphorylation and an increase in heat production. May be involved in protecting plant cells against oxidative stress damage. Recombinant PUMP5, reconstituted into liposomes, transports a wide range of dicarboxylic acids including malate, oxaloacetate and succinate as well as phosphate, sulfate and thiosulfate. However, it is unknown if these transports are of any biological significance in vivo.confidentQ9SJY5
Mitochondrial dicarboxylate transporter Mitochondrial dicarboxylic transporter catalyzing the exchange of dicarboxylic acids like malate and succinate for inorganic phosphate. Required for growth on ethanol and acetate.probableQ06143
Probable mitochondrial 2-oxoglutarate/malate carrier protein Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.probableQ54PY7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 3-39,56-304
View the alignment between query and template
View the model in PyMOL