BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021524
         (311 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4EQ4|A Chain A, Crystal Structure Of Seleno-Methionine Derivatized Gh3.12
 pdb|4EQ4|B Chain B, Crystal Structure Of Seleno-Methionine Derivatized Gh3.12
          Length = 581

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 11  YKMEYYKGTHAQWNMM---PQHQMKEPNNALVMNKKIMAILAERDAAIRERNIALTEKRE 67
           +K +Y+K   + W      P   +  PNN   +   ++  L +RD  +R  +I  +    
Sbjct: 171 FKSDYFKNRPSNWYYSYTSPDEVILCPNNTESLYCHLLCGLVQRDEVVRTGSIFASVXVR 230

Query: 68  ALETRDQALEE 78
           A+E    + EE
Sbjct: 231 AIEVLKNSWEE 241


>pdb|4EWV|A Chain A, Crystal Structure Of Gh3.12 In Complex With Ampcpp
 pdb|4EWV|B Chain B, Crystal Structure Of Gh3.12 In Complex With Ampcpp
 pdb|4EPM|A Chain A, Crystal Structure Of Arabidopsis Gh3.12 (Pbs3) In Complex
           With Amp
 pdb|4EQL|A Chain A, Crystal Structure Of Gh3.12 In Complex With Amp And
           Salicylate
 pdb|4EQL|B Chain B, Crystal Structure Of Gh3.12 In Complex With Amp And
           Salicylate
          Length = 581

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 11  YKMEYYKGTHAQWNMM---PQHQMKEPNNALVMNKKIMAILAERDAAIRERNIALTEKRE 67
           +K +Y+K   + W      P   +  PNN   +   ++  L +RD  +R  +I  +    
Sbjct: 171 FKSDYFKNRPSNWYYSYTSPDEVILCPNNTESLYCHLLCGLVQRDEVVRTGSIFASVMVR 230

Query: 68  ALETRDQALEE 78
           A+E    + EE
Sbjct: 231 AIEVLKNSWEE 241


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.130    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,075,747
Number of Sequences: 62578
Number of extensions: 338083
Number of successful extensions: 617
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 616
Number of HSP's gapped (non-prelim): 3
length of query: 311
length of database: 14,973,337
effective HSP length: 99
effective length of query: 212
effective length of database: 8,778,115
effective search space: 1860960380
effective search space used: 1860960380
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 51 (24.3 bits)