Citrus Sinensis ID: 021555


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MVTSSSLVCSPLTAPLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAWTEK
cccccccccccccccccccccccccHHccccccHHHHHHHHHHcccccccccccccCCcccccccccccccccHHcHHHHHHcccccEEccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHccccccccCEEEcccccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHcccCEccccccccccHHHHHHcHHHHHHccccccccEEEEccccccccccHHHHHHHcccccEEEEEEEcccccccccccccccccccccccccEEEEEEEccc
********CSPLTAPLC*************************************SVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAWT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTSSSLVCSPLTAPLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAWTEK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine synthase, chloroplastic/chromoplastic probableP47999
O-acetylserine sulfhydrylase Catalyzes the conversion of O-acetylserine (OAS) to cysteine through the elimination of acetate and addition of hydrogen sulfide.probableP0A535
O-acetylserine sulfhydrylase Catalyzes the conversion of O-acetylserine (OAS) to cysteine through the elimination of acetate and addition of hydrogen sulfide.probableP0A534

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.47Cysteine synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AEC, chain A
Confidence level:very confident
Coverage over the Query: 68-304
View the alignment between query and template
View the model in PyMOL
Template: 3PC3, chain A
Confidence level:very confident
Coverage over the Query: 30-304
View the alignment between query and template
View the model in PyMOL