Citrus Sinensis ID: 021575


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MAGTGVVAVYGNDGAITETKKSPFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAVMALERVPADIRSQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYVDESEVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVKRAQAIVRAVTHYSDPEVLAEVSCGLGEAMVGLNLSDHKVERFASRSE
cccccEEEEccccccccccccccHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccEEEEEEccccHHHHHcccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccCEEEcccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccHHHHHcccc
****GVV**YGN**A****KKSPFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAVMALERVPADIRSQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYVDESEVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVKRAQAIVRAVTHYSDPEVLAEVSCGLGEAMVGLNLSDHK**R******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGTGVVAVYGNDGAITETKKSPFSVKVGLAQMLRGGVIMDVVTPEQARVAEEAGACAVMALERVPADIRSQGGVARMSDPQLIKEIKQSVTIPVMAKARIGHFVEAQILEAIGIDYVDESEVLTPADEENHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVMGDIRVLRNMDDDEVFTFAKKIAAPYDLVMQTKQLGRLPVVHFAAGGVATPADAAMMMQLGCDGVFVGSGVFKSGDPVKRAQAIVRAVTHYSDPEVLAEVSCGLGEAMVGLNLSDHKVERFASRSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyridoxal biosynthesis protein PDX1.3 Involved in the production of pyridoxal (vitamin B6). Also plays an indirect role in osmotic or salt tolerance, and in resistance to singlet oxygen-generating photosensitizers.confidentQ8L940
Pyridoxal biosynthesis lyase PdxS Involved in the production of pyridoxal phosphate, probably by incorporating ammonia into the pyridine ring.confidentA9WFT9
Pyridoxal biosynthesis lyase PdxS Involved in the production of pyridoxal phosphate, probably by incorporating ammonia into the pyridine ring.confidentA9B891

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YZR, chain A
Confidence level:very confident
Coverage over the Query: 23-294
View the alignment between query and template
View the model in PyMOL