BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 021625
(310 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3MDU|A Chain A, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
From Pseudomonas Aeruginosa Complexed With
N-Guanidino-L-Glutamate
pdb|3MDW|A Chain A, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
From Pseudomonas Aeruginosa Complexed With
N-Formimino-L-Aspartate
pdb|3MDW|B Chain B, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
From Pseudomonas Aeruginosa Complexed With
N-Formimino-L-Aspartate
pdb|3MDW|C Chain C, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
From Pseudomonas Aeruginosa Complexed With
N-Formimino-L-Aspartate
pdb|3MDW|D Chain D, The Structure Of N-Formimino-L-Glutamate Iminohydrolase
From Pseudomonas Aeruginosa Complexed With
N-Formimino-L-Aspartate
Length = 453
Score = 27.7 bits (60), Expect = 8.4, Method: Compositional matrix adjust.
Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
Query: 116 IIGLCSIMSKDPGLITNEFPHLDKLVEGSELGVDPDNENSLS 157
+ GLC +S + L FP D L +G LG+ D+ SLS
Sbjct: 287 VAGLC--LSTEANLGDGIFPATDFLAQGGRLGIGSDSHVSLS 326
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.330 0.141 0.469
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,502,035
Number of Sequences: 62578
Number of extensions: 317920
Number of successful extensions: 758
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 758
Number of HSP's gapped (non-prelim): 1
length of query: 310
length of database: 14,973,337
effective HSP length: 99
effective length of query: 211
effective length of database: 8,778,115
effective search space: 1852182265
effective search space used: 1852182265
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 51 (24.3 bits)