Citrus Sinensis ID: 021642

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31

MPRYDDRYGGTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIVEFARGGPRGPGGSREYLGRGPPPGSGRCFNCGIDGHWARDCKAGDWKNKCYRCGERGHIERNCQNSPKKLRPRSYSRSPSPRRGRSRSRSYSRGRSDSRSRSPVKRDRSVERFERRTRSPRDSRSPKRRRNSPPSSKGRKRSPTPDERSPQDQRSPSPRDRRQANGSEYSGSPRGKSRSPVDDADGPEDRNYRSPPEENGRSRSRSLSPVPRDDRSPIDDDDNHGDPRGSESN

cccccccccccEEEEccccccccHHHHHHHHccccccEEEEEcccEEEEEEccHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*******YGGTRLYVGRLASRTRSRDLEEIFSRYGRIRDVDMKRDFAFVEFSDPRDADDARYSLNGRDVDGSRIIV**************************RCFNCGIDGHWARDCKAGDWKNKCYRCGERGHI******************************************************************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/arginine-rich splicing factor RS2Z32	Involved in pre-mRNA splicing.	probable	Q9FYB7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 7-82
View the alignment between query and template
View the model in PyMOL

Template: 2LLI, chain A
Confidence level:very confident
Coverage over the Query: 102-142
View the alignment between query and template
View the model in PyMOL

Template: 3TS2, chain A
Confidence level:very confident
Coverage over the Query: 29-144
View the alignment between query and template
View the model in PyMOL