BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021662
         (309 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3O8O|A Chain A, Structure Of Phosphofructokinase From Saccharomyces
           Cerevisiae
 pdb|3O8O|C Chain C, Structure Of Phosphofructokinase From Saccharomyces
           Cerevisiae
 pdb|3O8O|E Chain E, Structure Of Phosphofructokinase From Saccharomyces
           Cerevisiae
 pdb|3O8O|G Chain G, Structure Of Phosphofructokinase From Saccharomyces
           Cerevisiae
          Length = 787

 Score = 28.1 bits (61), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/66 (22%), Positives = 28/66 (42%), Gaps = 7/66 (10%)

Query: 83  IMISYYALLWLACVLNLAWCSLQGWQCSAGKEVAWNLLSLFTVAAVLYLEISLMAFLLQE 142
           IM  +  L+    V  L+W  ++ W    G E+  N        +V   ++  +A+  Q+
Sbjct: 429 IMNGFSGLIQTGEVKELSWIDVENWHNLGGSEIGTNR-------SVASEDLGTIAYYFQK 481

Query: 143 SYASGL 148
           +   GL
Sbjct: 482 NKLDGL 487


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.141    0.453 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,536,421
Number of Sequences: 62578
Number of extensions: 318165
Number of successful extensions: 605
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 605
Number of HSP's gapped (non-prelim): 1
length of query: 309
length of database: 14,973,337
effective HSP length: 99
effective length of query: 210
effective length of database: 8,778,115
effective search space: 1843404150
effective search space used: 1843404150
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)