BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021719
         (308 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|1FQV|C Chain C, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|1FQV|E Chain E, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|1FQV|G Chain G, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|1FQV|I Chain I, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|1FQV|K Chain K, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|1FQV|M Chain M, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|1FQV|O Chain O, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|2ASS|B Chain B, Crystal Structure Of The Skp1-Skp2-Cks1 Complex
 pdb|2AST|B Chain B, Crystal Structure Of Skp1-Skp2-Cks1 In Complex With A
          P27 Peptide
          Length = 336

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 11 WEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLWKTLDLS 58
          W+ L +++L+ IF    + EL   ++ VC  W     D  LW+TLDL+
Sbjct: 9  WDSLPDELLLGIFSCLCLPELLK-VSGVCKRWYRLASDESLWQTLDLT 55


>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|1FS2|C Chain C, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
          Length = 272

 Score = 31.2 bits (69), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 11 WEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLWKTLD 56
          W+ L +++L+ IF    + EL   ++ VC  W     D  LW+TLD
Sbjct: 9  WDSLPDELLLGIFSCLCLPELLK-VSGVCKRWYRLASDESLWQTLD 53


>pdb|1FS1|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
 pdb|1FS1|C Chain C, Insights Into Scf Ubiquitin Ligases From The Structure
          Of The Skp1-Skp2 Complex
          Length = 53

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 11 WEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLWKTLD 56
          W+ L +++L+ IF    + EL   ++ VC  W     D  LW+TLD
Sbjct: 9  WDSLPDELLLGIFSCLCLPELLK-VSGVCKRWYRLASDESLWQTLD 53


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.139    0.435 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,315,252
Number of Sequences: 62578
Number of extensions: 294488
Number of successful extensions: 874
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 869
Number of HSP's gapped (non-prelim): 9
length of query: 308
length of database: 14,973,337
effective HSP length: 99
effective length of query: 209
effective length of database: 8,778,115
effective search space: 1834626035
effective search space used: 1834626035
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)