Citrus Sinensis ID: 021733

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MDFWPEFMASSWGREFVAGGFGGIAGVVSGYPLDTLRIQQQSSTSGSAFSILRRTVATEGPQALYRGMGAPLASVTFQNAMVFQIYAILSRALDPSISAKEPPSYKVVALAGVGTGAIQSLILSPVELVKIRLQLQGSNYTRSKQADRYKGPTDVARSILRREGLRGIYRGLSITVLRDAPSHGFYFWTYECMREQLHPGCRKNGQESLQTMLVAGGLAGVASWVCCYPLDVVKTRLQAQSPSSVLKYNGIVDCFYKSVKADGYSVLWRGLGAAVARAFVVNGAIFAAYEVALRCLFHNGSIQTENTI
ccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHcccccEEEHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
*DFWPEFMASSWGREFVAGGFGGIAGVVSGYPLDTLRIQQQSSTSGSAFSILRRTVATEGPQALYRGMGAPLASVTFQNAMVFQIYAILSRALDPSISA**PPSYKVVALAGVGTGAIQSLILSPVELVKIRLQLQGSN************PTDVARSILRREGLRGIYRGLSITVLRDAPSHGFYFWTYECMREQLHPGCRKNGQESLQTMLVAGGLAGVASWVCCYPLDVVKTRLQAQSPSSVLKYNGIVDCFYKSVKADGYSVLWRGLGAAVARAFVVNGAIFAAYEVALRCLFHN*********
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFWPEFMASSWGREFVAGGFGGIAGVVSGYPLDTLRIQQQSSTSGSAFSILRRTVATEGPQALYRGMGAPLASVTFQNAMVFQIYAILSRALDPSISAKEPPSYKVVALAGVGTGAIQSLILSPVELVKIRLQLQGSNYTRSKQADRYKGPTDVARSILRREGLRGIYRGLSITVLRDAPSHGFYFWTYECMREQLHPGCRKNGQESLQTMLVAGGLAGVASWVCCYPLDVVKTRLQAQSPSSVLKYNGIVDCFYKSVKADGYSVLWRGLGAAVARAFVVNGAIFAAYEVALRCLFHNGSIQTENTI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial arginine transporter BAC2 Mitochondrial arginine transporter that catalyzes the counter-exchange of arginine with lysine, ornithine, arginine, histidine and citrulline. Substrate preference in reconstituted proteoliposomes is arginine > homoarginine > citrulline > histidine > lysine > ornithine. May be involved in the delivery of arginine, released from seed reserves, to mitochondrial arginase and the export of ornithine. May contribute to proline accumulation in response to hyperosmotic stress.confidentQ9CA93
Carrier protein YMC1, mitochondrial probableP32331
Mitochondrial substrate carrier family protein D Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane.probableQ55E85

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 14-300
View the alignment between query and template
View the model in PyMOL