BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 021757
(308 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3L5Z|A Chain A, Crystal Structure Of Transcriptional Regulator, Gntr
Family From Bacillus Cereus
pdb|3L5Z|B Chain B, Crystal Structure Of Transcriptional Regulator, Gntr
Family From Bacillus Cereus
Length = 156
Score = 31.2 bits (69), Expect = 0.78, Method: Compositional matrix adjust.
Identities = 15/49 (30%), Positives = 23/49 (46%)
Query: 101 VIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQT 149
VIP A V + +Y++ KL L +R ++P+DK N T
Sbjct: 62 VIPGVEASVLEESIYSYIQNKLGLKVGTSVVRVKGIRPDDKEKQFXNLT 110
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.126 0.341
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,546,871
Number of Sequences: 62578
Number of extensions: 165588
Number of successful extensions: 285
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 284
Number of HSP's gapped (non-prelim): 1
length of query: 308
length of database: 14,973,337
effective HSP length: 99
effective length of query: 209
effective length of database: 8,778,115
effective search space: 1834626035
effective search space used: 1834626035
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 51 (24.3 bits)