Citrus Sinensis ID: 021759


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MEVSQSSTSSSSSQETEISGRNTQPLIPGLPDEIGELCLLHVPYPYQALAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVYA
ccccccccccccccCEECccccccccccccccccccccccccccccccccccccccCEEEEEEccEEEEEccccccccccccEEEEEEcccccEEEccccccccccCEEEEEccEEEEEccccccccccccEEEEECccccCEEEccccccccccEEEEEEccEEEEEccccccccccccEEEECcccccEEEccccccccccEEEEEEccEEEEEEcccccEEEEEccccccEEEEcccccccccccccCEEEEEccEEEEEEccccccEEEEEEEEEccccccEEEECcccccccEEEEEEEEEEc
********************RNTQPLIPGLPDEIGELCLLHVPYPYQALAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVYA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVSQSSTSSSSSQETEISGRNTQPLIPGLPDEIGELCLLHVPYPYQALAVCPQAFACTSLPRQGKLFVLGGMRSDTETPMQSTIMYRATTNQWQLASPMLTPRSFFASGNVNGKIMAVGGTGANINETMTAVECYDPESDTWTTAAKLRMGLARYDSAVMGSKMYVTEGWTWPFMFSPRGGVYDINKDTWNLMSDGMKEGWTGISIVLEGKLFVISEHGDCPMKQYNPDDDTWRYVGGDKFPCEVMHRPFAVNGVEGKIYVVSSGLNVAIGRVYEEQNGGISAEWKVMTAPRAFKDLAPSSCQVVYA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box protein AFR Component of SCF (ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Part of the phyA-mediated signaling transduction pathway leading to the regulation of gene expression and hypocotyls elongation in response to red and far-red light exposure.probableQ8LAW2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VPJ, chain A
Confidence level:very confident
Coverage over the Query: 64-291
View the alignment between query and template
View the model in PyMOL
Template: 2WOZ, chain A
Confidence level:very confident
Coverage over the Query: 56-304
View the alignment between query and template
View the model in PyMOL