BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 021780
(307 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3E5P|A Chain A, Crystal Structure Of Alanine Racemase From E.Faecalis
pdb|3E5P|B Chain B, Crystal Structure Of Alanine Racemase From E.Faecalis
pdb|3E5P|C Chain C, Crystal Structure Of Alanine Racemase From E.Faecalis
pdb|3E6E|A Chain A, Crystal Structure Of Alanine Racemase From E.Faecalis
Complex With Cycloserine
pdb|3E6E|B Chain B, Crystal Structure Of Alanine Racemase From E.Faecalis
Complex With Cycloserine
pdb|3E6E|C Chain C, Crystal Structure Of Alanine Racemase From E.Faecalis
Complex With Cycloserine
Length = 371
Score = 31.6 bits (70), Expect = 0.52, Method: Compositional matrix adjust.
Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 10/122 (8%)
Query: 19 TMQAQRVAPPDLQCKDKFLIQGIVVPFGTSDEDITSDMFAKDSGKYVEEKKLRVILMSPP 78
T QA R +Q +FL +GI F T+DE I + F K +G++ K + +L P
Sbjct: 148 TKQAVRF----VQSHKEFLWEGIFTHFSTADE-IDTSYFEKQAGRF---KAVLAVLEELP 199
Query: 79 QSPVLLPRNGELKQDSSPETSLQKDRALSGVENIPPGDGVAANAEVFETAKFADELTETK 138
+ + L P ++ A+ G+ P G+ +A + + + EL K
Sbjct: 200 RYVHVSNSATALWHPDVPGNMIRYGVAMYGLN--PSGNKLAPSYALKPALRLTSELIHVK 257
Query: 139 DL 140
L
Sbjct: 258 RL 259
>pdb|3P0J|A Chain A, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
Tyrosinol, Triclinic Crystal Form 1
pdb|3P0J|B Chain B, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
Tyrosinol, Triclinic Crystal Form 1
pdb|3P0J|C Chain C, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
Tyrosinol, Triclinic Crystal Form 1
pdb|3P0J|D Chain D, Leishmania Major Tyrosyl-Trna Synthetase In Complex With
Tyrosinol, Triclinic Crystal Form 1
Length = 690
Score = 30.0 bits (66), Expect = 1.8, Method: Compositional matrix adjust.
Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 3/65 (4%)
Query: 12 ILCKTQFTMQAQRVAPPDLQCKDKFLIQGIVVPFGTSDEDITSDMFAKDSGKYVEEKKLR 71
I+ KT+ T+ A +V P +QC D F ++ + G + +M A++ + +KL+
Sbjct: 156 IMGKTEGTLTAAQVLYPLMQCCDIFFLKADICQLGLDQRKV--NMLAREYCDLI-GRKLK 212
Query: 72 VILMS 76
+++S
Sbjct: 213 PVILS 217
>pdb|1TLL|A Chain A, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase
Reductase Module At 2.3 A Resolution.
pdb|1TLL|B Chain B, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase
Reductase Module At 2.3 A Resolution
Length = 688
Score = 29.3 bits (64), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%)
Query: 149 RDESRAAKDVQMFGTT----NVTNKLREAKDVQTFESSKDIDELISA 191
RD++R +D+ FG T VTN+LR ES KD DE+ S+
Sbjct: 644 RDDNRYHEDI--FGVTLRTYEVTNRLRSESIAFIEESKKDADEVFSS 688
>pdb|2UV9|A Chain A, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UV9|B Chain B, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UV9|C Chain C, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UV9|D Chain D, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UV9|E Chain E, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UV9|F Chain F, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Alpha Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVB|A Chain A, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVB|B Chain B, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVB|C Chain C, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVB|D Chain D, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVB|E Chain E, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVB|F Chain F, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Alpha Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
Length = 1878
Score = 27.7 bits (60), Expect = 7.5, Method: Compositional matrix adjust.
Identities = 27/73 (36%), Positives = 37/73 (50%), Gaps = 6/73 (8%)
Query: 52 ITSDMF-AKDSGKYVEEKKLRVILMSPPQSPVLLPRNGELKQDSSPETSLQKDRALSGVE 110
I + +F AKD Y + + +V L PQS V NGELK + P T D+ SG +
Sbjct: 1674 INNKLFVAKDKAPYEDRIQSKVFLN--PQSRVTQESNGELKFPAEPVTP-TGDKKQSGTQ 1730
Query: 111 NIPPGDGVAANAE 123
P + AA+AE
Sbjct: 1731 T--PSESDAASAE 1741
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.131 0.357
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,497,075
Number of Sequences: 62578
Number of extensions: 343204
Number of successful extensions: 756
Number of sequences better than 100.0: 37
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 33
Number of HSP's that attempted gapping in prelim test: 749
Number of HSP's gapped (non-prelim): 40
length of query: 307
length of database: 14,973,337
effective HSP length: 99
effective length of query: 208
effective length of database: 8,778,115
effective search space: 1825847920
effective search space used: 1825847920
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 51 (24.3 bits)