Citrus Sinensis ID: 021801


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQSPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQLSVLNRSLS
cccEEEEEEcHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEccccccccccEEEEEccccccHHHHHcccccEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEcccccEEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEEEEccccccccccccccccccEEEEEEEcccccEEEEEEcccccEEEEEEEccccEEEccccccccccccccccccEEEEEEcccccEEEEEEccc
cccEEEEEccHHHHHHHHHHHHHHcccccccccccccccccHcccccccHHEEcccccccEEEEEEccccccHHHHHHHHccccEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEccccccccEEEEEcccccEEEEEccccEEEEEEHHHcEEEEEEccccccEEEEEEEEccccccccccccccccccEEEEEEEEcccccEEEEEEEccccEEEEEEcccccEEEEccccccccccccccccEEEEEEccccccEEEEEEEcc
mpgvlarfdgSEIQKMLQRWFqdsnsnfwdqkpkqrdsedLENSYerlphqlwnvskygpcadaaitglmppplmevqssqRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWrseqspkksepkpqsfaraspltclkdhprkgerltlspsgslAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKdaatssayyapvksdyclclaihaprkGIIEVWqmrtgprlltiqcakgskilqptyrfgssmasspyvpleVFLLNGDSGQLSVLNRSLS
mpgvlarfdgSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAilskvvpatfstiSSLSKMIWRSEqspkksepkpqsfaraspltclkdhprkgerltlspsgsLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLlngdsgqlsvlnrsls
MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQSPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQLSVLNRSLS
****************LQRWF**************************LPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIW******************************************LAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNG*************
*PGVLARFDGSEIQKMLQRW**************************RLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLS***************************CLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFME**********************LCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQLSVLNRSL*
MPGVLARFDGSEIQKMLQRWFQDSNSNFWD*************SYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMI*******************ASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQLSVLNRSLS
MPGVLARFDGSEIQKMLQRWFQDSNS****************NSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRS*************FARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNK***********VKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQLSVLNRSLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQSPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQLSVLNRSLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query307 2.2.26 [Sep-21-2011]
Q9H2M9 1393 Rab3 GTPase-activating pr yes no 0.817 0.180 0.285 1e-21
Q8BMG7 1366 Rab3 GTPase-activating pr yes no 0.736 0.165 0.285 3e-21
Q5U1Z0 1386 Rab3 GTPase-activating pr yes no 0.726 0.160 0.297 4e-21
Q9VKB9 1341 Rab3 GTPase-activating pr yes no 0.648 0.148 0.274 1e-16
Q22670 1307 Rab3 GTPase-activating pr yes no 0.276 0.065 0.291 2e-05
>sp|Q9H2M9|RBGPR_HUMAN Rab3 GTPase-activating protein non-catalytic subunit OS=Homo sapiens GN=RAB3GAP2 PE=1 SV=1 Back     alignment and function desciption
 Score =  103 bits (258), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/291 (28%), Positives = 140/291 (48%), Gaps = 40/291 (13%)

Query: 48  LPHQLWNVSKYGPCADAAITGLM---PPPLMEVQSSQRYFCA------------VTIGED 92
           L ++ W +       D A  G+M   P   M+  S+   F A            +T+G +
Sbjct: 251 LAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTASNIGGFNAAIKNSPPAMSQYITVGSN 310

Query: 93  SVISAFRLSEDRSRSLVG----AILSKVVPATFSTISSLSKMIWRS---EQSPKKSEPKP 145
                F   E  ++ L+     A+ SK+  A F+  S    + W+S   E++ +K +PK 
Sbjct: 311 PFTGFFYALEGSTQPLLSHVALAVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPKV 368

Query: 146 QSFARASPLTC---LKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGY 202
           +    A+PL     L D  R GE + LSP  +LAA+TD  GR++LLD    + +R+WKGY
Sbjct: 369 EP---ATPLAVRFGLPDSRRHGESICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGY 425

Query: 203 RDASCVFMEMLVN-KDAATSSAYYAPVK-----SDYCLCLAIHAPRKGIIEVWQMRTGPR 256
           RDA   +++ + +  +     A ++P       S     L I+APR+GI+EVW  + GPR
Sbjct: 426 RDAQIGWIQTVEDLHERVPEKADFSPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPR 485

Query: 257 LLTIQCAKGSKILQPTYRFG--SSMASSPYVP--LEVFLLNGDSGQLSVLN 303
           +      K  ++L P Y+    +++ S  + P   ++ L++  SG +  +N
Sbjct: 486 VGAFNVGKHCRLLYPGYKIMGLNNVTSQSWQPQTYQICLVDPVSGSVKTVN 536




Regulatory subunit of a GTPase activating protein that has specificity for Rab3 subfamily (RAB3A, RAB3B, RAB3C and RAB3D). Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. Rab3 GTPase-activating complex specifically converts active Rab3-GTP to the inactive form Rab3-GDP. Required for normal eye and brain development. May participate in neurodevelopmental processes such as proliferation, migration and differentiation before synapse formation, and non-synaptic vesicular release of neurotransmitters.
Homo sapiens (taxid: 9606)
>sp|Q8BMG7|RBGPR_MOUSE Rab3 GTPase-activating protein non-catalytic subunit OS=Mus musculus GN=Rab3gap2 PE=1 SV=2 Back     alignment and function description
>sp|Q5U1Z0|RBGPR_RAT Rab3 GTPase-activating protein non-catalytic subunit OS=Rattus norvegicus GN=Rab3gap2 PE=1 SV=2 Back     alignment and function description
>sp|Q9VKB9|RBGPR_DROME Rab3 GTPase-activating protein regulatory subunit OS=Drosophila melanogaster GN=rab3-GAP PE=1 SV=2 Back     alignment and function description
>sp|Q22670|RBGPR_CAEEL Rab3 GTPase-activating protein regulatory subunit OS=Caenorhabditis elegans GN=rbg-2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
225461677 457 PREDICTED: rab3 GTPase-activating protei 0.996 0.669 0.867 1e-156
224116998354 predicted protein [Populus trichocarpa] 0.996 0.864 0.809 1e-146
255567076 484 rab3 gtpase-activating protein non-catal 0.967 0.613 0.810 1e-141
15231948 455 uncharacterized protein [Arabidopsis tha 1.0 0.674 0.783 1e-141
356543215 459 PREDICTED: rab3 GTPase-activating protei 0.993 0.664 0.802 1e-141
297830038 455 hypothetical protein ARALYDRAFT_478912 [ 1.0 0.674 0.779 1e-141
449456579 456 PREDICTED: rab3 GTPase-activating protei 0.993 0.668 0.774 1e-140
449516756 456 PREDICTED: rab3 GTPase-activating protei 0.993 0.668 0.774 1e-140
356514563 460 PREDICTED: rab3 GTPase-activating protei 0.993 0.663 0.786 1e-138
115478506 469 Os09g0315800 [Oryza sativa Japonica Grou 0.993 0.650 0.726 1e-128
>gi|225461677|ref|XP_002285458.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit [Vitis vinifera] gi|302142895|emb|CBI20190.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  558 bits (1438), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/309 (86%), Positives = 294/309 (95%), Gaps = 3/309 (0%)

Query: 1   MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGP 60
           MPGV+ARFDG+++Q MLQRWFQD++S FWD+KPK+RD ED E SY RLP+QLWNVSKYGP
Sbjct: 150 MPGVIARFDGADLQSMLQRWFQDTHSQFWDEKPKRRDQEDSEKSYGRLPYQLWNVSKYGP 209

Query: 61  CADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPAT 120
           CADAAITG MPPPLME+QSSQRY+CAVTIG+D+VISAFRLSEDR+RSLVGAILSKVVPAT
Sbjct: 210 CADAAITGTMPPPLMELQSSQRYYCAVTIGDDAVISAFRLSEDRNRSLVGAILSKVVPAT 269

Query: 121 FSTISSLSKMIWRSEQ-SPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAIT 179
           FSTI+S SKMIWRSEQ SPK+SEPKPQ FARASPLTCLKDHPRKGE+LTLSPSG+LAAIT
Sbjct: 270 FSTIASFSKMIWRSEQKSPKRSEPKPQPFARASPLTCLKDHPRKGEKLTLSPSGTLAAIT 329

Query: 180 DSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKD-AATSSAYYAPVKSDYCLCLAI 238
           DSLGRILLLDTQALVVVRLWKGYRDASC+F EMLV+KD AA+SS+YY PVKSDYCLCLAI
Sbjct: 330 DSLGRILLLDTQALVVVRLWKGYRDASCLFTEMLVSKDTAASSSSYYEPVKSDYCLCLAI 389

Query: 239 HAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQ 298
           HAPRKGI+EVWQMRTGPRLLT+QC+KGSKILQPTYRFGSSM  SPYVPLEVFLLNGDSGQ
Sbjct: 390 HAPRKGIVEVWQMRTGPRLLTVQCSKGSKILQPTYRFGSSMG-SPYVPLEVFLLNGDSGQ 448

Query: 299 LSVLNRSLS 307
           LSVLNRSL+
Sbjct: 449 LSVLNRSLN 457




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224116998|ref|XP_002331804.1| predicted protein [Populus trichocarpa] gi|222874500|gb|EEF11631.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255567076|ref|XP_002524520.1| rab3 gtpase-activating protein non-catalytic subunit, putative [Ricinus communis] gi|223536194|gb|EEF37847.1| rab3 gtpase-activating protein non-catalytic subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15231948|ref|NP_188109.1| uncharacterized protein [Arabidopsis thaliana] gi|8777474|dbj|BAA97054.1| unnamed protein product [Arabidopsis thaliana] gi|63147384|gb|AAY34165.1| At3g14910 [Arabidopsis thaliana] gi|115646783|gb|ABJ17116.1| At3g14910 [Arabidopsis thaliana] gi|332642066|gb|AEE75587.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356543215|ref|XP_003540058.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|297830038|ref|XP_002882901.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. lyrata] gi|297328741|gb|EFH59160.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449456579|ref|XP_004146026.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516756|ref|XP_004165412.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356514563|ref|XP_003525975.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|115478506|ref|NP_001062848.1| Os09g0315800 [Oryza sativa Japonica Group] gi|51091645|dbj|BAD36414.1| rab3-GAP regulatory domain-like [Oryza sativa Japonica Group] gi|113631081|dbj|BAF24762.1| Os09g0315800 [Oryza sativa Japonica Group] gi|218201904|gb|EEC84331.1| hypothetical protein OsI_30840 [Oryza sativa Indica Group] gi|222641308|gb|EEE69440.1| hypothetical protein OsJ_28835 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
TAIR|locus:2086390455 AT3G14910 "AT3G14910" [Arabido 1.0 0.674 0.783 9.3e-130
UNIPROTKB|E1BVG8 1386 RAB3GAP2 "Uncharacterized prot 0.697 0.154 0.316 9.9e-23
UNIPROTKB|E2R4W9 1540 RAB3GAP2 "Uncharacterized prot 0.690 0.137 0.308 8.1e-22
UNIPROTKB|Q9H2M9 1393 RAB3GAP2 "Rab3 GTPase-activati 0.690 0.152 0.308 1.2e-21
UNIPROTKB|D4ABP4 1367 Rab3gap2 "Rab3 GTPase-activati 0.690 0.155 0.308 1.8e-21
ZFIN|ZDB-GENE-030616-610 1373 rab3gap2 "RAB3 GTPase activati 0.589 0.131 0.341 4.3e-21
RGD|1311518 1386 Rab3gap2 "RAB3 GTPase activati 0.690 0.152 0.303 5e-21
MGI|MGI:1916043 1366 Rab3gap2 "RAB3 GTPase activati 0.690 0.155 0.303 8e-21
UNIPROTKB|F1S9J9 1391 RAB3GAP2 "Uncharacterized prot 0.690 0.152 0.303 8.2e-21
UNIPROTKB|G5E601 1392 RAB3GAP2 "Uncharacterized prot 0.690 0.152 0.299 1.7e-20
TAIR|locus:2086390 AT3G14910 "AT3G14910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1273 (453.2 bits), Expect = 9.3e-130, P = 9.3e-130
 Identities = 242/309 (78%), Positives = 275/309 (88%)

Query:     1 MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGP 60
             +PGV+ARFDGS IQ M+Q+W Q+ NSNFWDQK ++ D+ED  + Y+RLP+Q+WNV+K G 
Sbjct:   147 LPGVIARFDGSNIQSMVQKWVQEKNSNFWDQKNRKGDAEDTGSLYQRLPYQIWNVNKNGV 206

Query:    61 CADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPAT 120
             C DA +TG+MPPPL+E+QSSQRY+CAVTIGEDSVISA+RLSEDR RSLVGAILSKVVPA 
Sbjct:   207 CVDATVTGVMPPPLLELQSSQRYYCAVTIGEDSVISAYRLSEDRGRSLVGAILSKVVPAA 266

Query:   121 FSTISSLSKMIWRS-EQSPK-KSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAI 178
              STI+S SK+IWRS +QSPK K E K QSFARAS LTC+KD+PRKGE+LTLSPSG+LAAI
Sbjct:   267 ASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGEKLTLSPSGTLAAI 326

Query:   179 TDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAI 238
             TDSLGRILLLDTQALVVVRLWKGYRDASCVFMEML  KD   S  +  PVKSDYCLCLAI
Sbjct:   327 TDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKGKSVIHTEPVKSDYCLCLAI 386

Query:   239 HAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQ 298
             HAPRKGIIEVWQMRTGPRLLTIQCAKGSK+LQP YRFGS+ +SSPY+PLEVFLLNGDSGQ
Sbjct:   387 HAPRKGIIEVWQMRTGPRLLTIQCAKGSKLLQPAYRFGSNSSSSPYIPLEVFLLNGDSGQ 446

Query:   299 LSVLNRSLS 307
             +S+LNRSLS
Sbjct:   447 VSMLNRSLS 455




GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|E1BVG8 RAB3GAP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4W9 RAB3GAP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2M9 RAB3GAP2 "Rab3 GTPase-activating protein non-catalytic subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4ABP4 Rab3gap2 "Rab3 GTPase-activating protein non-catalytic subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-610 rab3gap2 "RAB3 GTPase activating protein subunit 2 (non-catalytic)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1311518 Rab3gap2 "RAB3 GTPase activating protein subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1916043 Rab3gap2 "RAB3 GTPase activating protein subunit 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9J9 RAB3GAP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G5E601 RAB3GAP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 307
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 100.0
KOG2727 1244 consensus Rab3 GTPase-activating protein, non-cata 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 97.07
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.05
KOG0266 456 consensus WD40 repeat-containing protein [General 96.98
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 96.92
PTZ00421 493 coronin; Provisional 96.79
KOG0649325 consensus WD40 repeat protein [General function pr 96.75
KOG0299 479 consensus U3 snoRNP-associated protein (contains W 96.75
KOG0263707 consensus Transcription initiation factor TFIID, s 96.36
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.32
PTZ00421 493 coronin; Provisional 96.25
PTZ00420 568 coronin; Provisional 95.94
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.91
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 95.85
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 95.77
KOG0263707 consensus Transcription initiation factor TFIID, s 95.61
KOG0271 480 consensus Notchless-like WD40 repeat-containing pr 95.55
PTZ00420 568 coronin; Provisional 95.33
KOG0296 399 consensus Angio-associated migratory cell protein 95.08
KOG0279315 consensus G protein beta subunit-like protein [Sig 94.92
KOG0639705 consensus Transducin-like enhancer of split protei 94.82
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 94.59
PLN00181 793 protein SPA1-RELATED; Provisional 94.56
KOG0265 338 consensus U5 snRNP-specific protein-like factor an 94.53
KOG0316 307 consensus Conserved WD40 repeat-containing protein 94.42
KOG0282 503 consensus mRNA splicing factor [Function unknown] 94.33
KOG2727 1244 consensus Rab3 GTPase-activating protein, non-cata 94.19
KOG0284 464 consensus Polyadenylation factor I complex, subuni 94.15
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 94.15
KOG0315311 consensus G-protein beta subunit-like protein (con 94.05
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 93.69
KOG0286343 consensus G-protein beta subunit [General function 93.6
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 93.19
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 93.12
KOG0279 315 consensus G protein beta subunit-like protein [Sig 93.1
KOG1273 405 consensus WD40 repeat protein [General function pr 92.84
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 92.52
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 92.24
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 92.18
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 92.17
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 92.13
KOG1407313 consensus WD40 repeat protein [Function unknown] 92.01
KOG0285 460 consensus Pleiotropic regulator 1 [RNA processing 91.72
PRK03629429 tolB translocation protein TolB; Provisional 91.45
KOG1912 1062 consensus WD40 repeat protein [General function pr 91.43
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 91.28
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 91.07
KOG0308 735 consensus Conserved WD40 repeat-containing protein 90.95
PLN00181793 protein SPA1-RELATED; Provisional 90.89
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 90.83
KOG0310 487 consensus Conserved WD40 repeat-containing protein 90.71
KOG1188 376 consensus WD40 repeat protein [General function pr 90.5
KOG0318603 consensus WD40 repeat stress protein/actin interac 89.88
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 89.74
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 89.46
KOG0295406 consensus WD40 repeat-containing protein [Function 89.44
KOG0282503 consensus mRNA splicing factor [Function unknown] 89.01
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 88.77
KOG0316307 consensus Conserved WD40 repeat-containing protein 88.76
KOG0318 603 consensus WD40 repeat stress protein/actin interac 88.52
KOG0288459 consensus WD40 repeat protein TipD [General functi 87.26
KOG0275508 consensus Conserved WD40 repeat-containing protein 86.57
KOG0286 343 consensus G-protein beta subunit [General function 86.19
PRK11028 330 6-phosphogluconolactonase; Provisional 86.13
PRK11028330 6-phosphogluconolactonase; Provisional 86.09
KOG1539 910 consensus WD repeat protein [General function pred 85.83
KOG0295 406 consensus WD40 repeat-containing protein [Function 85.36
PRK01742429 tolB translocation protein TolB; Provisional 85.13
KOG1274 933 consensus WD40 repeat protein [General function pr 85.05
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 83.58
KOG0281499 consensus Beta-TrCP (transducin repeats containing 83.3
KOG0280339 consensus Uncharacterized conserved protein [Amino 83.3
PRK02889427 tolB translocation protein TolB; Provisional 82.88
KOG0289506 consensus mRNA splicing factor [General function p 82.85
PRK04792448 tolB translocation protein TolB; Provisional 82.73
KOG0296 399 consensus Angio-associated migratory cell protein 82.69
PRK01742429 tolB translocation protein TolB; Provisional 82.53
COG2319 466 FOG: WD40 repeat [General function prediction only 82.25
KOG0267 825 consensus Microtubule severing protein katanin p80 82.0
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 81.77
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 81.6
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 81.56
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 81.37
KOG0301 745 consensus Phospholipase A2-activating protein (con 80.31
smart0032040 WD40 WD40 repeats. Note that these repeats are per 80.19
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
Probab=100.00  E-value=2.9e-73  Score=559.48  Aligned_cols=257  Identities=36%  Similarity=0.550  Sum_probs=212.7

Q ss_pred             CCceEEEEechhHHHHHHHHHHhhccccCCCCCccCCcccccCCCCCccccccccCCCcceeeeEEeccCCCCchhhh--
Q 021801            1 MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQ--   78 (307)
Q Consensus         1 y~~~i~~i~G~~l~~~L~~c~~q~~~~~~~~~~~~~~~~~~~~~~~~L~ykKW~~~~~~~i~Daa~~G~~~pp~~~~~--   78 (307)
                      ||++||+|||+||+++|++|++|++++.|+.       .+ ...+++|+||||+|++++.|+|++++|+++|++|||.  
T Consensus       136 y~~~v~~Idg~sL~~~L~~~~~~~~~~~~~~-------~~-~~~~~~L~ykKw~l~~~~~i~D~~~~G~~~~~~fd~l~~  207 (415)
T PF14655_consen  136 YPSAVVIIDGFSLFSVLRACRNQVARGAASG-------SD-SPAPPPLSYKKWNLQSQDTINDAAICGPMPPSTFDHLVT  207 (415)
T ss_pred             ECCEEEEEecHHHHHHHHHHHHhhhhhhhcc-------cc-cCCCCccceeEecCCCCCcEeeEEEecCCCCcHHHHHHh
Confidence            8999999999999999999999999984222       22 3457889999999999999999999999999999973  


Q ss_pred             ------------ccccceeEEEecCCceeEEEeecCCCCcchhhHHHhhhhh-HHHHHHHhhhhhhccC--CCCCCC-CC
Q 021801           79 ------------SSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVP-ATFSTISSLSKMIWRS--EQSPKK-SE  142 (307)
Q Consensus        79 ------------s~~~~~~~i~vG~~P~la~y~~~~~~~~s~~~a~~s~va~-Av~s~~~s~ak~~W~~--~~~~~~-~e  142 (307)
                                  +...++++|++|++||+|||+++|+.+++    ++++|+. +|+++++++.+.+|+.  +.++++ ++
T Consensus       208 aS~~gf~a~~~~s~~~~~~~i~~G~~P~v~f~~~~e~~s~~----~ls~va~~aVas~l~sav~~~lg~~~~~~~~~~~~  283 (415)
T PF14655_consen  208 ASIGGFNAKYRSSPPRMSRYITVGSSPFVSFYYASEGSSQP----LLSDVASSAVASKLTSAVSGWLGWGSWRSEQQPQE  283 (415)
T ss_pred             hhcccccceeecCCcceEEEEEecCCceEEEEEccCCCCcc----cHHHHHHHHHHHHHHhhhHhhcccCCCCCcccccc
Confidence                        34577899999999999999988877775    5667777 8888888876644433  332221 11


Q ss_pred             -----CCCCCcccCCCCccccCCCceeeEEEECCCCCEEEEEcCCCcEEEEEcCCceeEEeecccccceeeEEEEEeccc
Q 021801          143 -----PKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKD  217 (307)
Q Consensus       143 -----~~p~~~~~a~pl~~l~D~~R~~~~I~lsP~~~lAavtDslGRV~LiD~~~~~ivRmWKGyRDAqc~Wi~~~~~~~  217 (307)
                           +++++.++....++|+|++|++++|++||+++|||+||+||||+|+|+++++|||||||||||||+|+++.++.+
T Consensus       284 ~~~~~~~~~~~~~l~~r~~l~D~~R~~~~i~~sP~~~laA~tDslGRV~LiD~~~~~vvrmWKGYRdAqc~wi~~~~~~~  363 (415)
T PF14655_consen  284 KQPPEPKPEPAAPLPMRFGLPDSKREGESICLSPSGRLAAVTDSLGRVLLIDVARGIVVRMWKGYRDAQCGWIEVPEEGD  363 (415)
T ss_pred             ccccccCcCCCcccceEEeeccCCceEEEEEECCCCCEEEEEcCCCcEEEEECCCChhhhhhccCccceEEEEEeecccc
Confidence                 122332222233679999999999999999999999999999999999999999999999999999999999876


Q ss_pred             ccccccccCCCCCCcceEEEEEcCCCCeEEEeecCCCCeEEEEEecCCeEEe
Q 021801          218 AATSSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKIL  269 (307)
Q Consensus       218 ~~~~~~~~~~~k~~~~l~LVIyaprRg~lEVW~~~~G~RV~a~~v~~~~~Ll  269 (307)
                      +..+..+....+.+.+|||||||||||+||||+||||+||+||+|+|+||||
T Consensus       364 ~~~~~~~~~~~~~~~~l~LvIyaprRg~lEvW~~~~g~Rv~a~~v~k~~rLl  415 (415)
T PF14655_consen  364 RDRSNSNSPKSSSRFALFLVIYAPRRGILEVWSMRQGPRVAAFNVGKGCRLL  415 (415)
T ss_pred             cccccccccCCCCcceEEEEEEeccCCeEEEEecCCCCEEEEEEeCCCcEEC
Confidence            5333334444556679999999999999999999999999999999999997



>KOG2727 consensus Rab3 GTPase-activating protein, non-catalytic subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG2727 consensus Rab3 GTPase-activating protein, non-catalytic subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 40.2 bits (93), Expect = 8e-04
 Identities = 49/292 (16%), Positives = 86/292 (29%), Gaps = 83/292 (28%)

Query: 2   PGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERL-PHQLWNVSKYGP 60
           P  L+      I+  L  W      + W      + +  +E+S   L P +   +  +  
Sbjct: 327 PRRLSII-AESIRDGLATW------DNWKHVNCDKLTTIIESSLNVLEPAEYRKM--FDR 377

Query: 61  CA----DAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLV------G 110
            +     A I    P  L+ +      +  V   +  V+    +++    SLV       
Sbjct: 378 LSVFPPSAHI----PTILLSL-----IWFDVIKSDVMVV----VNKLHKYSLVEKQPKES 424

Query: 111 AI----LSKVVPATFSTISSLSKMIWRSEQSPKKSEP----KPQ------SFARASPLTC 156
            I    +   +        +L + I      PK  +      P       S         
Sbjct: 425 TISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSH-------- 476

Query: 157 LKDH---PRKGERLTLSPSGSL----------AAITDSLGRILLLDTQALVVVRLWKGYR 203
           +  H       ER+TL     L             T       +L+T  L  ++ +K Y 
Sbjct: 477 IGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNT--LQQLKFYKPYI 534

Query: 204 DASCVFMEMLVN------KDAATSSAYYAPVKSDYC--LCLAIHAPRKGIIE 247
             +    E LVN           +      + S Y   L +A+ A  + I E
Sbjct: 535 CDNDPKYERLVNAILDFLPKIEENL-----ICSKYTDLLRIALMAEDEAIFE 581


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.97
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 97.83
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 97.82
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.7
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.67
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.67
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.63
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.63
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 97.62
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 97.47
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 97.47
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.43
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.37
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 97.36
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.36
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.35
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 97.34
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 97.33
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.32
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.31
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.3
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.29
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.28
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.27
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 97.27
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 97.27
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.24
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 97.23
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.23
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.21
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.2
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.2
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.18
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.18
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.18
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.17
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.16
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.16
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.16
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 97.15
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.14
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.12
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.11
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.11
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.09
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.09
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.07
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.05
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.04
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.04
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.0
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.97
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.95
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 96.93
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 96.93
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 96.87
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 96.85
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 96.82
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.8
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 96.79
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 96.78
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.78
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 96.77
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 96.75
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.74
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 96.74
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 96.72
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.72
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.71
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.7
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.63
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 96.62
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 96.62
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 96.57
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 96.57
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.56
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.56
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.55
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.54
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.54
2ymu_A577 WD-40 repeat protein; unknown function, two domain 96.54
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 96.51
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.49
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 96.47
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.46
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.44
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 96.41
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.41
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 96.37
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.36
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.36
2pm7_B 297 Protein transport protein SEC13, protein transport 96.36
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.35
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.32
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.32
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.31
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.31
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.28
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.28
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.26
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.26
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.18
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.14
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 96.13
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 96.13
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 96.11
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.1
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.08
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.05
2xyi_A430 Probable histone-binding protein CAF1; transcripti 96.04
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 96.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.86
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.85
3jro_A 753 Fusion protein of protein transport protein SEC13 95.84
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.81
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 95.75
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.65
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.65
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 95.64
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 95.6
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.58
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.5
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.45
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.44
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 95.42
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.38
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.37
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.31
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.0
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 94.88
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.85
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.84
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 94.69
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 94.66
2pm7_B297 Protein transport protein SEC13, protein transport 94.64
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.61
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.59
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 94.55
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 94.21
3jro_A 753 Fusion protein of protein transport protein SEC13 94.18
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 94.1
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.99
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 93.99
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 93.95
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 93.87
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 93.77
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.57
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 93.53
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 93.37
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.37
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 93.26
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.24
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 93.17
1k32_A 1045 Tricorn protease; protein degradation, substrate g 93.0
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.86
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.76
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 92.73
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 92.48
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 92.35
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 92.34
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 92.33
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 92.33
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 92.25
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 92.23
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.05
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 91.94
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 91.76
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 91.67
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 91.6
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 91.39
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 91.31
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 91.14
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 90.95
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 90.81
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 90.1
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 90.09
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 89.82
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 89.7
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 89.47
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 89.08
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 88.6
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 88.37
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 88.3
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 88.28
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 88.24
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 88.2
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 88.09
2ece_A 462 462AA long hypothetical selenium-binding protein; 87.2
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 86.68
1q7f_A 286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 86.55
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 86.29
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 86.0
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 85.47
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 85.26
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 84.87
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 84.71
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 84.63
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 84.5
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 84.4
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 84.37
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 84.21
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 82.9
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 82.46
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 81.96
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 81.6
1k32_A 1045 Tricorn protease; protein degradation, substrate g 81.42
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 81.33
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 80.82
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=97.97  E-value=0.0002  Score=62.57  Aligned_cols=90  Identities=11%  Similarity=0.066  Sum_probs=71.8

Q ss_pred             cccCCCceeeEEEECCCCCEEEEEcCCCcEEEEEcCCceeEEeecccccceeeEEEEEecccccccccccCCCCCCcceE
Q 021801          156 CLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLC  235 (307)
Q Consensus       156 ~l~D~~R~~~~I~lsP~~~lAavtDslGRV~LiD~~~~~ivRmWKGyRDAqc~Wi~~~~~~~~~~~~~~~~~~k~~~~l~  235 (307)
                      .|..+...+.+|+.+|+++++++++..|.|.++|+.++..++.++|+.+.    |....-.             ++..  
T Consensus        27 ~l~~h~~~v~~~~~s~~~~~l~~~~~dg~i~vwd~~~~~~~~~~~~h~~~----v~~~~~~-------------~~~~--   87 (369)
T 3zwl_B           27 KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGT----IWSIDVD-------------CFTK--   87 (369)
T ss_dssp             EEECCSSCEEEEEECTTSCEEEEEESSSCEEEEETTTCCEEEEECCCSSC----EEEEEEC-------------TTSS--
T ss_pred             EEEEeeceEEEEEEcCCCCEEEEEeCCCEEEEEeCCCchhhhhhhhcCCc----EEEEEEc-------------CCCC--
Confidence            38889999999999999999999999999999999999999999998873    3221110             0111  


Q ss_pred             EEEEcCCCCeEEEeecCCCCeEEEEEecC
Q 021801          236 LAIHAPRKGIIEVWQMRTGPRLLTIQCAK  264 (307)
Q Consensus       236 LVIyaprRg~lEVW~~~~G~RV~a~~v~~  264 (307)
                      +++.+-.+|.|.||+++++..+..+....
T Consensus        88 ~l~s~~~dg~i~iwd~~~~~~~~~~~~~~  116 (369)
T 3zwl_B           88 YCVTGSADYSIKLWDVSNGQCVATWKSPV  116 (369)
T ss_dssp             EEEEEETTTEEEEEETTTCCEEEEEECSS
T ss_pred             EEEEEeCCCeEEEEECCCCcEEEEeecCC
Confidence            33566779999999999999998887433



>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.69
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 97.64
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.55
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 97.51
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.46
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.43
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.36
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.27
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.25
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.19
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.13
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.07
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.98
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 96.9
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.88
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 96.88
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.86
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 96.83
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.83
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.81
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.72
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.67
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.55
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.4
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 95.7
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.7
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 95.67
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.59
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.54
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 95.46
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.39
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 95.38
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 95.33
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.29
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.28
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.21
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 95.03
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.95
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 94.52
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.27
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 92.84
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 92.78
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 91.35
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 91.22
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 90.64
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 87.62
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: F-box/WD-repeat protein 1 (beta-TRCP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.69  E-value=0.00021  Score=57.15  Aligned_cols=87  Identities=18%  Similarity=0.204  Sum_probs=64.7

Q ss_pred             ccccCCCceeeEEEECCCCCEEEEEcCCCcEEEEEcCCceeEEeecccccceeeEEEEEecccccccccccCCCCCCcce
Q 021801          155 TCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCL  234 (307)
Q Consensus       155 ~~l~D~~R~~~~I~lsP~~~lAavtDslGRV~LiD~~~~~ivRmWKGyRDAqc~Wi~~~~~~~~~~~~~~~~~~k~~~~l  234 (307)
                      .++.+..+.+.  |++|+|+++|+....|.|.|+|+.++..++.++|+.+.    |..... +              .. 
T Consensus         9 ~~~~~~~~~V~--c~~~d~~~l~sgs~Dg~i~vWd~~~~~~~~~l~~H~~~----V~~v~~-~--------------~~-   66 (293)
T d1p22a2           9 HCRSETSKGVY--CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGS----VLCLQY-D--------------ER-   66 (293)
T ss_dssp             ECCCSSCCCEE--EEECCSSEEEEEESSSCEEEEESSSCCEEEEECCCSSC----EEEEEC-C--------------SS-
T ss_pred             eccCCCCCCEE--EEEEcCCEEEEEeCCCeEEEEECCCCcEEEEEecCCCC----Eeeeec-c--------------cc-
Confidence            44555555554  57899999999999999999999999999999999883    332221 1              01 


Q ss_pred             EEEEEcCCCCeEEEeecCCCCeEEEEEecC
Q 021801          235 CLAIHAPRKGIIEVWQMRTGPRLLTIQCAK  264 (307)
Q Consensus       235 ~LVIyaprRg~lEVW~~~~G~RV~a~~v~~  264 (307)
                       +++-+..+|.|.+|+++.+..........
T Consensus        67 -~l~s~s~D~~i~~~~~~~~~~~~~~~~~~   95 (293)
T d1p22a2          67 -VIITGSSDSTVRVWDVNTGEMLNTLIHHC   95 (293)
T ss_dssp             -EEEEEETTSCEEEEESSSCCEEEEECCCC
T ss_pred             -eeecccccccccccccccccccccccccc
Confidence             34567789999999999888776665443



>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure