BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021823
         (307 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2YUG|A Chain A, Solution Structure Of Mouse Frg1 Protein
          Length = 155

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 9/67 (13%)

Query: 50  SQNIIRLKSCYGKYLTASNQPFLLGMTGRKVIQSVPGRLDSSVEWEPVREANQVKLKTRY 109
           S + I LKS YGKYL  ++   ++G +           +    +WEPV +  ++ L    
Sbjct: 70  SDSRIALKSGYGKYLGINSDGLVVGRS---------DAIGPREQWEPVFQDGKMALLASN 120

Query: 110 GHFLRAN 116
             F+R N
Sbjct: 121 SCFIRCN 127


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.131    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,918,091
Number of Sequences: 62578
Number of extensions: 349455
Number of successful extensions: 612
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 611
Number of HSP's gapped (non-prelim): 1
length of query: 307
length of database: 14,973,337
effective HSP length: 99
effective length of query: 208
effective length of database: 8,778,115
effective search space: 1825847920
effective search space used: 1825847920
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 51 (24.3 bits)