BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 021856
(306 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q8HYX8|MCP_CALJA Membrane cofactor protein OS=Callithrix jacchus GN=CD46 PE=1 SV=2
Length = 392
Score = 31.2 bits (69), Expect = 9.2, Method: Compositional matrix adjust.
Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 7/59 (11%)
Query: 13 PASSSSSSTTSHQQSSTTSSTTSHQPSSTTSPPEPSLKQPQVPASSGFPAFGNGEGGML 71
P SS+ T SH S ++S T+ P+S+ S P P+ K P S +P + N + GML
Sbjct: 288 PPSSTKPPTLSH---SVSTSPTTVSPTSSVSGPRPTYK----PPVSRYPGYPNPDEGML 339
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.312 0.128 0.372
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 120,087,721
Number of Sequences: 539616
Number of extensions: 5467305
Number of successful extensions: 45108
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 409
Number of HSP's successfully gapped in prelim test: 442
Number of HSP's that attempted gapping in prelim test: 33261
Number of HSP's gapped (non-prelim): 8767
length of query: 306
length of database: 191,569,459
effective HSP length: 117
effective length of query: 189
effective length of database: 128,434,387
effective search space: 24274099143
effective search space used: 24274099143
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)