Citrus Sinensis ID: 021861
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 306 | ||||||
| 224125856 | 472 | predicted protein [Populus trichocarpa] | 0.918 | 0.595 | 0.587 | 6e-75 | |
| 224118068 | 487 | predicted protein [Populus trichocarpa] | 0.892 | 0.560 | 0.593 | 2e-73 | |
| 110931850 | 321 | MYB transcription factor MYB131 [Glycine | 0.774 | 0.738 | 0.617 | 4e-72 | |
| 356560061 | 477 | PREDICTED: uncharacterized protein LOC77 | 0.944 | 0.605 | 0.55 | 8e-70 | |
| 302398987 | 461 | MYBR domain class transcription factor [ | 0.947 | 0.629 | 0.556 | 2e-66 | |
| 356531046 | 466 | PREDICTED: uncharacterized protein LOC10 | 0.862 | 0.566 | 0.584 | 8e-65 | |
| 356531048 | 450 | PREDICTED: uncharacterized protein LOC10 | 0.859 | 0.584 | 0.578 | 1e-63 | |
| 449507174 | 480 | PREDICTED: uncharacterized LOC101217341 | 0.813 | 0.518 | 0.578 | 2e-60 | |
| 449439603 | 490 | PREDICTED: uncharacterized protein LOC10 | 0.813 | 0.508 | 0.578 | 2e-60 | |
| 255570631 | 463 | conserved hypothetical protein [Ricinus | 0.839 | 0.555 | 0.498 | 8e-49 |
| >gi|224125856|ref|XP_002329734.1| predicted protein [Populus trichocarpa] gi|222870642|gb|EEF07773.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 286 bits (733), Expect = 6e-75, Method: Compositional matrix adjust.
Identities = 172/293 (58%), Positives = 209/293 (71%), Gaps = 12/293 (4%)
Query: 3 NSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQ 62
N L SF +D++PKVRKPYTITKQREKWTEEEHQRFL+ALK+YGRGWR+I+EHVGTKTAVQ
Sbjct: 38 NELNSFGSDNIPKVRKPYTITKQREKWTEEEHQRFLEALKLYGRGWRKIQEHVGTKTAVQ 97
Query: 63 IRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKSVDSLKATSVSNQQE 122
IRSHAQK FSKVV ES+G +ESS+ PIEIPPPRPKRKP HPYPRKSVD K T S+Q +
Sbjct: 98 IRSHAQKIFSKVVWESSGGNESSLKPIEIPPPRPKRKPAHPYPRKSVDIRKGTPASSQLD 157
Query: 123 NFTSSNALVSDKDRQSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEK 182
S N+ S+KD SPTSV+SA SDTLG A S+Q N CSSPTSCTT+MHS++L P K
Sbjct: 158 GSPSPNSSASEKDNLSPTSVLSALASDTLGTALSEQHNACSSPTSCTTDMHSISLPPSVK 217
Query: 183 ENEYVTSISFPKEEKISTLPAHLSAS------SNVEELASVSKDSVYPKGDAAAAPSCTS 236
E E++TS S +E+K + +S S S EL S D+V +GDA S TS
Sbjct: 218 EAEHLTSNSSREEDKETFSLIEMSCSPLEKFLSKKFELG--SDDTVCAEGDATKEASSTS 275
Query: 237 IKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWI 289
IKLFG TV+V+ S K GA+ S S +Q+N D DK+ +P Q++ +
Sbjct: 276 IKLFGMTVMVAASHKKSPPGAEFVLSMTSNENQDNADTDKE----KPAQTLLL 324
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224118068|ref|XP_002317724.1| predicted protein [Populus trichocarpa] gi|222858397|gb|EEE95944.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|110931850|gb|ABH02924.1| MYB transcription factor MYB131 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356560061|ref|XP_003548314.1| PREDICTED: uncharacterized protein LOC778089 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|302398987|gb|ADL36788.1| MYBR domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|356531046|ref|XP_003534089.1| PREDICTED: uncharacterized protein LOC100101861 isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531048|ref|XP_003534090.1| PREDICTED: uncharacterized protein LOC100101861 isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449507174|ref|XP_004162953.1| PREDICTED: uncharacterized LOC101217341 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449439603|ref|XP_004137575.1| PREDICTED: uncharacterized protein LOC101217341 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255570631|ref|XP_002526271.1| conserved hypothetical protein [Ricinus communis] gi|223534402|gb|EEF36108.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 306 | ||||||
| TAIR|locus:2014114 | 372 | EPR1 "EARLY-PHYTOCHROME-RESPON | 0.245 | 0.201 | 0.733 | 6.7e-43 | |
| TAIR|locus:2169135 | 287 | RVE2 "REVEILLE 2" [Arabidopsis | 0.271 | 0.289 | 0.698 | 3.1e-35 | |
| TAIR|locus:2167210 | 387 | RVE1 "REVEILLE 1" [Arabidopsis | 0.248 | 0.196 | 0.75 | 5e-35 | |
| TAIR|locus:504955668 | 336 | AT3G10113 [Arabidopsis thalian | 0.245 | 0.223 | 0.733 | 4.3e-32 | |
| TAIR|locus:2200970 | 645 | LHY "LATE ELONGATED HYPOCOTYL" | 0.215 | 0.102 | 0.742 | 7.8e-26 | |
| TAIR|locus:2044345 | 608 | CCA1 "circadian clock associat | 0.222 | 0.111 | 0.75 | 4e-24 | |
| TAIR|locus:2151251 | 293 | LCL1 "LHY/CCA1-like 1" [Arabid | 0.212 | 0.221 | 0.611 | 2.3e-22 | |
| TAIR|locus:2025411 | 287 | ASG4 "ALTERED SEED GERMINATION | 0.261 | 0.278 | 0.573 | 2.4e-21 | |
| TAIR|locus:2075049 | 298 | RVE8 "REVEILLE 8" [Arabidopsis | 0.222 | 0.228 | 0.628 | 2.1e-20 | |
| TAIR|locus:2124928 | 303 | AT4G01280 [Arabidopsis thalian | 0.254 | 0.257 | 0.55 | 3.5e-20 |
| TAIR|locus:2014114 EPR1 "EARLY-PHYTOCHROME-RESPONSIVE1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 316 (116.3 bits), Expect = 6.7e-43, Sum P(2) = 6.7e-43
Identities = 55/75 (73%), Positives = 69/75 (92%)
Query: 11 DSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKF 70
+++ KVRKPYT+TKQREKW+EEEH RFL+A+K+YGRGWRQI+EH+GTKTAVQIRSHAQKF
Sbjct: 61 ENVVKVRKPYTVTKQREKWSEEEHDRFLEAIKLYGRGWRQIQEHIGTKTAVQIRSHAQKF 120
Query: 71 FSKVVRESNGSSESS 85
FSK+ +E++ SE S
Sbjct: 121 FSKMAQEADSRSEGS 135
|
|
| TAIR|locus:2169135 RVE2 "REVEILLE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167210 RVE1 "REVEILLE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955668 AT3G10113 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200970 LHY "LATE ELONGATED HYPOCOTYL" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044345 CCA1 "circadian clock associated 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151251 LCL1 "LHY/CCA1-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025411 ASG4 "ALTERED SEED GERMINATION 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075049 RVE8 "REVEILLE 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2124928 AT4G01280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_scaffold_122000043 | hypothetical protein (472 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| PtpRR9 | • | 0.702 | |||||||||
| estExt_fgenesh4_pm.C_LG_VI0700 | • | 0.702 | |||||||||
| estExt_fgenesh4_pg.C_LG_X0958 | • | 0.702 | |||||||||
| estExt_fgenesh4_pg.C_LG_V1131 | • | 0.702 | |||||||||
| estExt_fgenesh4_pg.C_LG_III0902 | • | 0.683 | |||||||||
| estExt_fgenesh4_pg.C_1680018 | • | 0.683 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 306 | |||
| TIGR01557 | 57 | TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai | 2e-13 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 9e-12 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 5e-11 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 5e-10 | |
| cd11660 | 50 | cd11660, SANT_TRF, Telomere repeat binding factor- | 1e-04 | |
| pfam13921 | 59 | pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do | 6e-04 |
| >gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Score = 63.6 bits (155), Expect = 2e-13
Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 6/57 (10%)
Query: 24 KQREKWTEEEHQRFLDALKMYGRG-W---RQI-EEHVGTK-TAVQIRSHAQKFFSKV 74
K R WTE+ H RFL A++ G W ++I E V T Q+ SH QK+ K
Sbjct: 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57 |
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family | Back alignment and domain information |
|---|
| >gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 306 | |||
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 99.58 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.54 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 99.31 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.23 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.19 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.12 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.91 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 98.81 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 98.78 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.76 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.7 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.61 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.6 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 98.45 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.43 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 98.31 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 97.67 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 97.09 | |
| PLN03162 | 526 | golden-2 like transcription factor; Provisional | 96.98 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 96.72 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 96.59 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.53 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 95.98 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 95.82 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 95.61 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 95.44 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 95.36 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 94.89 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 94.79 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 94.76 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 94.53 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 94.04 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 93.73 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 93.62 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 93.45 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 93.02 | |
| smart00426 | 68 | TEA TEA domain. | 92.75 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 92.46 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 91.75 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 91.42 | |
| PF01285 | 431 | TEA: TEA/ATTS domain family; InterPro: IPR000818 T | 90.88 | |
| KOG3841 | 455 | consensus TEF-1 and related transcription factor, | 90.73 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 90.07 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 86.23 |
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Probab=99.58 E-value=3.4e-15 Score=111.06 Aligned_cols=50 Identities=42% Similarity=0.632 Sum_probs=45.5
Q ss_pred cCCCCCCHHHHHHHHHHHHHhCcc-h---HHHHHHhC-CC-CHHHHHHHHHHHHHH
Q 021861 24 KQREKWTEEEHQRFLDALKMYGRG-W---RQIEEHVG-TK-TAVQIRSHAQKFFSK 73 (306)
Q Consensus 24 k~r~~WT~EEh~lFLEaLe~yGrg-W---k~IAe~Vg-TR-T~~QVRSHaQKYF~k 73 (306)
|.|..||+|||.+||+||+.||.+ | +.|+++++ +| |..||++|+||||.+
T Consensus 1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k 56 (57)
T TIGR01557 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLK 56 (57)
T ss_pred CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHcc
Confidence 356789999999999999999995 9 99998776 67 999999999999986
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. |
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03162 golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >smart00426 TEA TEA domain | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids | Back alignment and domain information |
|---|
| >KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 306 | ||||
| 2cu7_A | 72 | Solution Structure Of The Sant Domain Of Human Kiaa | 2e-05 |
| >pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 306 | |||
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 1e-23 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 2e-18 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 1e-17 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 3e-17 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 1e-15 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 2e-14 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 6e-14 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 8e-11 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 4e-09 | |
| 1vf9_A | 64 | Telomeric repeat binding factor 2; MYB, helix-turn | 4e-07 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 4e-07 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 3e-06 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 3e-06 | |
| 1w0u_A | 55 | Telomeric repeat binding factor 2; telomere, DNA-b | 6e-06 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 7e-06 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 1e-05 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 2e-05 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 4e-05 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 1e-04 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 1e-04 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 1e-04 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 2e-04 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 3e-04 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 5e-04 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 5e-04 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 6e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 8e-04 |
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
Score = 91.0 bits (226), Expect = 1e-23
Identities = 18/63 (28%), Positives = 35/63 (55%)
Query: 23 TKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGSS 82
+ KWT EE + F L +GR W +I + +G++T +Q++S+A+++F V+
Sbjct: 6 SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKE 65
Query: 83 ESS 85
+
Sbjct: 66 TPN 68
|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 306 | |||
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.69 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.65 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.63 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.56 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.54 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.49 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 99.45 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.45 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.44 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.43 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.38 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.37 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.36 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.36 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.33 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 99.01 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 99.3 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.28 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.27 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.22 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.19 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.17 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.16 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.16 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.16 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.16 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.16 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.09 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.08 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.04 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 99.04 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.04 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.98 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.98 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.97 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.97 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.96 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.95 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.91 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.89 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.89 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.81 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.74 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.64 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.62 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 98.06 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.72 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.58 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 97.3 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 96.98 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 95.71 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.43 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.43 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 96.25 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 95.87 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 94.95 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 94.66 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 94.42 | |
| 1ig6_A | 107 | MRF-2, modulator recognition factor 2; DNA binding | 94.18 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 91.19 | |
| 2hzd_A | 82 | Transcriptional enhancer factor TEF-1; DNA-binding | 90.98 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 85.87 | |
| 2li6_A | 116 | SWI/SNF chromatin-remodeling complex subunit SWI1; | 83.7 | |
| 2jxj_A | 96 | Histone demethylase jarid1A; ARID domain, chromati | 83.58 |
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.69 E-value=2e-17 Score=128.11 Aligned_cols=63 Identities=25% Similarity=0.419 Sum_probs=56.9
Q ss_pred CCCCCCCCCCcccccCCCCCCHHHHHHHHHHHHHhCcchHHHHHHhCCCCHHHHHHHHHHHHH
Q 021861 10 NDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSHAQKFFS 72 (306)
Q Consensus 10 ~~~~~K~RKPytitk~r~~WT~EEh~lFLEaLe~yGrgWk~IAe~VgTRT~~QVRSHaQKYF~ 72 (306)
....+|.++++.....+..||+|||++||+||++||.+|..||++||+||+.|||.||++|+.
T Consensus 2 ssg~~~~~~~~~~~~~~~~WT~eEd~~Ll~~v~~~G~~W~~IA~~v~~RT~~qcr~r~~~~~i 64 (79)
T 2yus_A 2 SSGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPI 64 (79)
T ss_dssp CCSSSCCCCCCCSSCCSCCCCHHHHHHHHHHHHHSSSCHHHHHHHHSSCCHHHHHHHHTTSCC
T ss_pred CCcccCccCCccccccCCCcCHHHHHHHHHHHHHhCCCHHHHHHHcCCCCHHHHHHHHHHhcc
Confidence 444568888988888999999999999999999999779999999999999999999998743
|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >2li6_A SWI/SNF chromatin-remodeling complex subunit SWI1; ligand binding, DNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jxj_A Histone demethylase jarid1A; ARID domain, chromatin regulator, developmental protein, dioxygenase, iron, metal-binding, nucleus, oxidoreductase; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 306 | ||||
| d1irza_ | 64 | a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th | 2e-15 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 8e-14 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 2e-13 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 2e-12 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 5e-11 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 5e-11 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 4e-09 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 3e-07 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 2e-06 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 8e-06 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 4e-05 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 7e-05 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 1e-04 | |
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 2e-04 | |
| d1ofcx1 | 52 | a.4.1.3 (X:799-850) SANT domain of the nucleosome | 0.002 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 0.003 |
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: GARP response regulators domain: Arr10-B species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 67.3 bits (164), Expect = 2e-15
Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 5/60 (8%)
Query: 24 KQREKWTEEEHQRFLDALKMYGRGWR---QIEEH--VGTKTAVQIRSHAQKFFSKVVRES 78
K R WT E H +FL A+ G +I + V T + SH QKF + + S
Sbjct: 5 KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVS 64
|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 306 | |||
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.61 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.61 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.47 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 99.46 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.45 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.42 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.41 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.39 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.38 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.3 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.24 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.22 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.15 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 99.07 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.92 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.63 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.53 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 97.56 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 96.68 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 95.34 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 94.13 | |
| d1kkxa_ | 102 | Transcription regulator Adr6 (Swi1) {Baker's yeast | 89.49 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 86.29 | |
| d1ig6a_ | 107 | MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta | 86.2 |
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Transcriptional adaptor 2-like, TADA2L, isoform b species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.61 E-value=2.9e-16 Score=109.23 Aligned_cols=45 Identities=31% Similarity=0.629 Sum_probs=43.0
Q ss_pred CCCCHHHHHHHHHHHHHhCcc-hHHHHHHhCCCCHHHHHHHHHHHH
Q 021861 27 EKWTEEEHQRFLDALKMYGRG-WRQIEEHVGTKTAVQIRSHAQKFF 71 (306)
Q Consensus 27 ~~WT~EEh~lFLEaLe~yGrg-Wk~IAe~VgTRT~~QVRSHaQKYF 71 (306)
..||.||+.+|+++|++||.+ |..||++||+||+.|||.||++||
T Consensus 2 ~~Wt~eEd~~L~~~v~~~G~~nW~~Ia~~~~~Rt~~Qcr~r~~~~f 47 (47)
T d1x41a1 2 PSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYF 47 (47)
T ss_dssp SSSCHHHHHHHHHHHHHTCTTCHHHHHHHHTTSCHHHHHHHHHHHT
T ss_pred cCCCHHHHHHHHHHHHHHCCccHHHHHHHcCCCCHHHHHHHHHHhC
Confidence 359999999999999999986 999999999999999999999998
|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|