Citrus Sinensis ID: 021867

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MNLIDGEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPSKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLKNASKLLLKDNPLSVTPFLQAMLDPILLSPWLKLSTWFQNDDPTPFDTLHGKSFWVYAGDEPKINNFFNEAMASDARLATRVVIHKCKDVFEGLNSLVDVGGGIGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKYVGGDMFEAIPPADAVLLKWILHDWNDEECVKILKKCKEAVTSDDKKGKVIIIDMIRENKKRG
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccHHHHHHHccccHHHHcccccHHHHHccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHcccccCEEEcccHHHHcccccccccEEEEccccccccccccEEEcccccccccHHHHHHHHHHHHHHccccccccEEEEEEEEccccccc
***********LLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPSKTRCVYRLMRILIHSGFFAQQTLN****NNDEEQGYVLKNASKLLLKDNPLSVTPFLQAMLDPILLSPWLKLSTWFQNDDPTPFDTLHGKSFWVYAGDEPKINNFFNEAMASDARLATRVVIHKCKDVFEGLNSLVDVGGGIGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKYVGGDMFEAIPPADAVLLKWILHDWNDEECVKILKKCKEAVTSDDKKGKVIIIDMIRE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLIDGEHDTELLEAQAHVWNHIFNFINSMSLKCAVELGIPDIINKHGKPMTLNELVSALTINPSKTRCVYRLMRILIHSGFFAQQTLNSSRNNNDEEQGYVLKNASKLLLKDNPLSVTPFLQAMLDPILLSPWLKLSTWFQNDDPTPFDTLHGKSFWVYAGDEPKINNFFNEAMASDARLATRVVIHKCKDVFEGLNSLVDVGGGIGTVAKAIAKAFPNLECTDFDLPHVVNGLESDLANLKYVGGDMFEAIPPADAVLLKWILHDWNDEECVKILKKCKEAVTSDDKKGKVIIIDMIRENKKRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tabersonine 16-O-methyltransferase 16-O-methyltransferase involved in the biosynthesis of vindoline. Highly specific for 16-hydroxytabersonine. No activity with tabersonine, 3-hydroxytyramine, 4-hydroxytyramine, 5-hydroxytryptamine (5HT), 2,3-dihydro-3-hydroxytabersonine, lochnericine, hoerhammericine, 16-hydroxy-2,3-dihydro-3-hydroxytabersonine, 16-hydroxylochnericine, 16-hydroxyhoerhammericine, quercetin, kaempferol and caffeic acid as substrates.probableB0EXJ8
8-hydroxyquercetin 8-O-methyltransferase 8-O-methyltransferase active on various hydroxylated flavonoid substrates, including 7,8,3'4'-tetrahydroxy-flavone, 7,8,4'-trihydroxy-flavone and 8-hydroxy-flavone 7-methyl ether.probableQ6VMW0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZG3, chain A
Confidence level:very confident
Coverage over the Query: 8-286
View the alignment between query and template
View the model in PyMOL