Citrus Sinensis ID: 021905

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MEVCYNANTIAGHPDVHSPVTTLTKENAPAFYEPDVQILTSGGLRIPVHASILVSASPVLENIIDRPRKHRSSEKVIPILGVPCGAVSSFVGFLYTSRCTEEEMEKYGIHLLALSHVYSVPQLKQRCTKGLGERLTIDNVVDVLQLARLCDAPDLYLRCMKLAASRFKAVEKTEGWKFLQDHDPWLELQILQFMDEAESRIKRTRRRRQEQGLYLQLSEAMECLEHICTEGCTSVGPYEVGPTKNRGPCSKFATCQGLQLLIRHFATCKKRVNGGCLRCKRMWQLLRLHSSMCEQSDSCRVPLCR
ccccccccccccccccccHHHHHHHHHccccccccEEEEcccccEECHHHHHHHcccHHHHHHHccccccccccccEEEccccHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccc
***CYNANTIAGHPDVHSPVTTLTKENAPAFYEPDVQILTSGGLRIPVHASILVSASPVLENIIDRPRKHR*SEKVIPILGVPCGAVSSFVGFLYTSRCTEEEMEKYGIHLLALSHVYSVPQLKQRCTKGLGERLTIDNVVDVLQLARLCDAPDLYLRCMKLAASRFKAVEKTEGWKFLQDHDPWLELQILQFMDE***************GLYLQLSEAMECLEHICTEGCTSVGPYEVGPTKNRGPCSKFATCQGLQLLIRHFATCKKRVNGGCLRCKRMWQLLRLHSSMCEQSDSCRVPLCR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVCYNANTIAGHPDVHSPVTTLTKENAPAFYEPDVQILTSGGLRIPVHASILVSASPVLENIIDRPRKHRSSEKVIPILGVPCGAVSSFVGFLYTSRCTEEEMEKYGIHLLALSHVYSVPQLKQRCTKGLGERLTIDNVVDVLQLARLCDAPDLYLRCMKLAASRFKAVEKTEGWKFLQDHDPWLELQILQFMDEAESRIKRTRRRRQEQGLYLQLSEAMECLEHICTEGCTSVGPYEVGPTKNRGPCSKFATCQGLQLLIRHFATCKKRVNGGCLRCKRMWQLLRLHSSMCEQSDSCRVPLCR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BTB/POZ and TAZ domain-containing protein 1 May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Also targeted for degradation by the 26S proteasome pathway. May be involved in gametophyte development.probableQ9FMK7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HQI, chain A
Confidence level:very confident
Coverage over the Query: 12-167
View the alignment between query and template
View the model in PyMOL
Template: 3T92, chain A
Confidence level:very confident
Coverage over the Query: 214-233,246-305
View the alignment between query and template
View the model in PyMOL