Citrus Sinensis ID: 021907

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----

MEPAVLDDIISRLLDFKNGRGGGGKQVQLSESEIRMLCTVSREIFLQQPNLLELAAPIKICGDIHGQYSDLLRLFEYGGFPPKANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALIDDKILCMHGGLSPDLINLDQIRKLPRPTDVPDSGLLCDLLWSDPGRDVKGWGMNDRGVSYTFGPDTVAEFLLKNDMDLVCRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNSGAMMSVDDSLMCSFQILKPTDKKPRFS

cccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccEEEEccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccEEECccccccccccccccHHHHHHHHccHHHHHHHHHHcccccccEEEcccEEEEccccccccccHHHHHcccccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHHccccEEEEccccccccccccccccEEEEEccccccccccccEEEEEEcccccEEEEEEcccccccccc

*EPAVLDDIISRLLDFKNGRGGGGKQVQLSESEIRMLCTVSREIFLQQPNLLELAAPIKICGDIHGQYSDLLRLFEYGGFPPKANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALIDDKILCMHGGLSPDLINLDQIRKLPRPTDVPDSGLLCDLLWSDPGRDVKGWGMNDRGVSYTFGPDTVAEFLLKNDMDLVCRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNSGAMMSVDDSLMCSFQIL**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Regulates NEK2 function in terms of kinase activity and centrosome number and splitting, both in the presence and absence of radiation-induced DNA damage. Regulator of neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development.	confident	Q3T0E7
Serine/threonine-protein phosphatase beta isoform	Required for cell adhesion in non-muscle tissues and in maintenance of muscle attachment. Vital for larval development.	confident	P48462
Serine/threonine-protein phosphatase PP1-beta catalytic subunit	Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.	confident	P62143

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.3.-	Phosphoric monoester hydrolases.	probable
3.1.3.16	Phosphoprotein phosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E7A, chain A
Confidence level:very confident
Coverage over the Query: 4-298
View the alignment between query and template
View the model in PyMOL