Citrus Sinensis ID: 021939

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MSDLDRQIEQLKKCEPLKESEVKALCLKAMEILVEESNVQRVDAPVTICGDIHGQFYDMKELFKVGGDCPKTNYLFLGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVNVWRYCTDIFDYLSLSALIENKIFSVHGGLSPAISTLDQIRTIDRKQEVPHDGAMCDLLWSDPEDIVDGWGLSPRGAGFLFGGSVVTSFNHSNNIDYICRAHQLVMEGYKWMFNNQIVTVWSAPNYCYRCGNVAAILELDENLNKQFRVFDAAPQESRGAPAKKPAPDYFL
cccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccEEcccEEEEccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccEEECccccccccccccccHHHHHHHHcccccHHHHHHHHHccccccEEEcccEEEECcccccccccHHHHHHccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHccccEEEEHHHHHccccEEEccccEEEEEcccccccccccEEEEEEEcccccEEEEEEccccccccccccccccccccc
MSDLDRQIEQLKKCEPLKESEVKALCLKAMEILVEESNVQRVDAPVTICGDIHGQFYDMKELFKVGGDCPKTNYLFLGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVNVWRYCTDIFDYLSLSALIENKIFSVHGGLSPAISTLDQIRTIDRKQEVPHDGAMCDLLWSDPEDIVDGWGLSPRGAGFLFGGSVVTSFNHSNNIDYICRAHQLVMEGYKWMFNNQIVTVWSAPNYCYRCGNVAAILELDENLNKQFRVF*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDLDRQIEQLKKCEPLKESEVKALCLKAMEILVEESNVQRVDAPVTICGDIHGQFYDMKELFKVGGDCPKTNYLFLGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVNVWRYCTDIFDYLSLSALIENKIFSVHGGLSPAISTLDQIRTIDRKQEVPHDGAMCDLLWSDPEDIVDGWGLSPRGAGFLFGGSVVTSFNHSNNIDYICRAHQLVMEGYKWMFNNQIVTVWSAPNYCYRCGNVAAILELDENLNKQFRVFDAAPQESRGAPAKKPAPDYFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase PP-X isozyme 2 confidentP48528
Serine/threonine-protein phosphatase 4 catalytic subunit Protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, DNA repair, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration. The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation and regulation of HDAC3. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on Ser-140 (gamma-H2AFX) generated during DNA replication and required for DNA double strand break repair (By similarity). Dephosphorylates NDEL1 at CDK1 phosphorylation sites and negatively regulates CDK1 activity in interphase. In response to DNA damage, catalyzes RPA2 dephosphorylation, an essential step for DNA repair since it allows the efficient RPA2-mediated recruitment of RAD51 to chromatin.confidentP97470
Serine/threonine-protein phosphatase 4 catalytic subunit Protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, DNA repair, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration. The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation and regulation of HDAC3. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on Ser-140 (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair. Dephosphorylates NDEL1 at CDK1 phosphorylation sites and negatively regulates CDK1 activity in interphase (By similarity). In response to DNA damage, catalyzes RPA2 dephosphorylation, an essential step for DNA repair since it allows the efficient RPA2-mediated recruitment of RAD51 to chromatin.confidentQ5R6K8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IE4, chain C
Confidence level:very confident
Coverage over the Query: 2-288
View the alignment between query and template
View the model in PyMOL