Citrus Sinensis ID: 021957

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MAQTSASTSSASLYSLVVSPNPSSNIDAHKLSHTFRPIGSRKPRKLVSIQKNLRNSSVRAVYSGKFWAPDRSYRQGIWSIRDDLQIPSSPYFPVHAQGPPPANPMVQERFQSVISQLFQHRIIRCGGAVDDDMANIIVAQLLYLDAIDPHKDIVIYVNSPGGSVTAGMAIFDTMKHIRPDVSTVCVGLAASMGAFLLSAGAKGKRYSLPNSRIMIHQPLGGAQGGQTDIDIQANEMLHHKANLNGYLAYHTGQSLEKINQDTDRDYFMSPKEAKDYGLIDGVIMNPLKALQPLPAAADGNDKSSV
cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccCECcccccccccccccHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccEEECccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHccccHHHccccccccccccccccccccccc
****************************************************LRNSSVRAVYSGKFWAPDRSYRQGIWSIRDDLQIPSSPYFPVHAQG*******VQERFQSVISQLFQHRIIRCGGAVDDDMANIIVAQLLYLDAIDPHKDIVIYVNSPGGSVTAGMAIFDTMKHIRPDVSTVCVGLAASMGAFLLSAGAKGKRYSLPNSRIMIHQPLGGAQGGQTDIDIQANEMLHHKANLNGYLAYHTGQSLEKINQDTDRDYFMSPKEAKDYGLIDGVIMNP*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQTSASTSSASLYSLVVSPNPSSNIDAHKLSHTFRPIGSRKPRKLVSIQKNLRNSSVRAVYSGKFWAPDRSYRQGIWSIRDDLQIPSSPYFPVHAQGPPPANPMVQERFQSVISQLFQHRIIRCGGAVDDDMANIIVAQLLYLDAIDPHKDIVIYVNSPGGSVTAGMAIFDTMKHIRPDVSTVCVGLAASMGAFLLSAGAKGKRYSLPNSRIMIHQPLGGAQGGQTDIDIQANEMLHHKANLNGYLAYHTGQSLEKINQDTDRDYFMSPKEAKDYGLIDGVIMNPLKALQPLPAAADGNDKSSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent Clp protease proteolytic subunit 5, chloroplastic Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.confidentQ9S834
ATP-dependent Clp protease proteolytic subunit 1 Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableQ3MFR5
ATP-dependent Clp protease proteolytic subunit Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableA8ZXB7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.21.-Serine endopeptidases.probable
3.4.21.92Endopeptidase Clp.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TG6, chain A
Confidence level:very confident
Coverage over the Query: 111-287
View the alignment between query and template
View the model in PyMOL