Citrus Sinensis ID: 021959


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MAEAETVSLMDFDEDENQNLKPKDNGKNVIVSGTPPDIKASPWVEKYRPQSLADVAAHRDIVDTIDRLTSENRLPHLLLYGPPGTGKTSTILAVARKLYGAQYHNMILELNASDDRGIDVVRQQIQDFASTQSFSFGVKASVKLVLLDEADAMTKDAQFALRRVIEKYTKNTRFALICNQVNKIIPALQSRCTRFRFAPLEPVHVTERLKHVIEAEGLDVTEGGLAALVRLCNGDMRKALNILQSTHMASQQITEEAVYLCTGNPLPKDIEQISYWLLNESFADSFKRIQNLSFIIRLVLFVLLL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHccccccccccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEEcccccccHHHHccccEEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccc
*****************************************PWVEKYRPQSLADVAAHRDIVDTIDRLTSENRLPHLLLYGPPGTGKTSTILAVARKLYGAQYHNMILELNASDDRGIDVVRQQIQDFASTQSFSFGVKASVKLVLLDEADAMTKDAQFALRRVIEKYTKNTRFALICNQVNKIIPALQSRCTRFRFAPLEPVHVTERLKHVIEAEGLDVTEGGLAALVRLCNGDMRKALNILQSTHMASQQITEEAVYLCTGNPLPKDIEQISYWLLNESFADSFKRIQNLSFIIRLVLFVLLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEAETVSLMDFDEDENQNLKPKDNGKNVIVSGTPPDIKASPWVEKYRPQSLADVAAHRDIVDTIDRLTSENRLPHLLLYGPPGTGKTSTILAVARKLYGAQYHNMILELNASDDRGIDVVRQQIQDFASTQSFSFGVKASVKLVLLDEADAMTKDAQFALRRVIEKYTKNTRFALICNQVNKIIPALQSRCTRFRFAPLEPVHVTERLKHVIEAEGLDVTEGGLAALVRLCNGDMRKALNILQSTHMASQQITEEAVYLCTGNPLPKDIEQISYWLLNESFADSFKRIQNLSFIIRLVLFVLLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Replication factor C subunit 5 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.probableQ9D0F6
Replication factor C subunit 3 Component of ATP-dependent clamp loader (RFC and RFC-like) complexes for DNA clamps, such as the POL30/PCNA homotrimer and the checkpoint clamp DDC1:MEC3:RAD17 complex. During a clamp loading circle, the RFC:clamp complex binds to DNA and the recognition of the double-stranded/single-stranded junction stimulates ATP hydrolysis by RFC. The complex presumably provides bipartite ATP sites in which one subunit supplies a catalytic site for hydrolysis of ATP bound to the neighboring subunit. Dissociation of RFC from the clamp leaves the clamp encircling DNA. Component of the replication factor C (RFC or activator 1) complex which loads POL30/PCNA and acts during elongation of primed DNA templates by DNA polymerase delta and epsilon. RFC has an essential but redundant activity in sister chromatid cohesion establishment. Component of the RFC-like complex CTF18-RFC which is required for efficient establishment of chromosome cohesion during S-phase and may load or unload POL30/PCNA. Component of the RFC-like RAD24-RFC complex which loads the checkpoint clamp DDC1:MEC3:RAD17 complex and is involved in DNA repair pathways. Component of the RFC-like ELG1-RFC complex which appears to have a role in DNA replication, replication fork re-start, recombination and repair. RFC3 supplies a catalytic site to the ATP site of RFC4.probableP38629
Replication factor C subunit 5 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.probableP40937

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SXJ, chain C
Confidence level:very confident
Coverage over the Query: 40-299
View the alignment between query and template
View the model in PyMOL