Citrus Sinensis ID: 021963

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----

MASGLRRFVGSLSRRNLSTACANKQLIQQHDGGVGSGKSLNLYSAINQALHIALETDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFAIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLSVEEVPEDDYMLPLSEAEVIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLPRSSGYWRFWC

cccHHHHHHcccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHccccccccccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccccccHHHHHHcccccEEEccccHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccEEEEECcccEEEEEccHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEcccccccc

***********************************SGKSLNLYSAINQALHIALETDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFAIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLSVEEVPEDDYMLPLSEAEVIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRLLPRSSGYWRFWC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
2-oxoisovalerate dehydrogenase subunit beta	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).	probable	Q5SLR3
2-oxoisovalerate dehydrogenase subunit beta	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).	probable	P37941
2-oxoisovalerate dehydrogenase subunit beta, mitochondrial	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).	probable	P35738

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.2.-.-	Acting on the aldehyde or oxo group of donors.	probable
1.2.4.-	2,4'-dihydroxyacetophenone dioxygenase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IK6, chain A
Confidence level:very confident
Coverage over the Query: 50-157,169-304
View the alignment between query and template
View the model in PyMOL