Citrus Sinensis ID: 021964


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MEESWGSGYKEYVAGLIAGVATVIVGHPFDTVKVKLQKHNTEVHGIRYKNGLHCTARILRTEGVRGLYRGATPSFLGMAFESSLLFGIYSQTKQLLQGGVQSGGPQPNVIIPSAAFGGSIISFVLCPSELVKCRMQVQGTDSLVPKSVRYTSPLDCALRTVKQEGVMAIFRGGSTTFLREAIGNAVFFSVYEHVRYYMHLKLKAASSDHSNLIDMGIGIVSGGLGGVAFWSAVLPLDVAKTIIQTAPDKNASTNPFQILNSIYRRAGLKGCYTGLGPTIMRAFPANATAIVTWELAGKLLGIKHG
cccccccHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHcccccccEEHHcHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccHHHHHHccccHHHHHHHHHHHHHHHccccc
*****GSGYKEYVAGLIAGVATVIVGHPFDTVKVKLQKHNTEVHGIRYKNGLHCTARILRTEGVRGLYRGATPSFLGMAFESSLLFGIYSQTKQLLQGGVQSGGPQPNVIIPSAAFGGSIISFVLCPSELVKCRMQVQGTDSLVPKSVRYTSPLDCALRTVKQEGVMAIFRGGSTTFLREAIGNAVFFSVYEHVRYYMHLKLKAASSDHSNLIDMGIGIVSGGLGGVAFWSAVLPLDVAKTIIQTAPDKNASTNPFQILNSIYRRAGLKGCYTGLGPTIMRAFPANATAIVTWELAGKLLGI***
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEESWGSGYKEYVAGLIAGVATVIVGHPFDTVKVKLQKHNTEVHGIRYKNGLHCTARILRTEGVRGLYRGATPSFLGMAFESSLLFGIYSQTKQLLQGGVQSGGPQPNVIIPSAAFGGSIISFVLCPSELVKCRMQVQGTDSLVPKSVRYTSPLDCALRTVKQEGVMAIFRGGSTTFLREAIGNAVFFSVYEHVRYYMHLKLKAASSDHSNLIDMGIGIVSGGLGGVAFWSAVLPLDVAKTIIQTAPDKNASTNPFQILNSIYRRAGLKGCYTGLGPTIMRAFPANATAIVTWELAGKLLGIKHG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial arginine transporter BAC1 Mitochondrial arginine transporter that catalyzes the counter-exchange of arginine with lysine, ornithine, arginine and histidine. Substrate preference in reconstituted proteoliposomes is arginine > lysine > ornithine > histidine. May be involved in the delivery of arginine, released from seed reserves, to mitochondrial arginase and the export of ornithine.probableQ84UC7
Congested-like trachea protein Putative mitochondrial carrier of unknown solute specificity. Required for gas-filling of the tracheal system at hatching time of the embryo and for normal epithelial morphogenesis of the wings.probableQ9VQG4
Protein dif-1 Seems to play a role in the maintenance of tissue differentiation in the developing embryo, but not for its initiation.probableQ27257

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 3-296
View the alignment between query and template
View the model in PyMOL