Citrus Sinensis ID: 021967


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MVGGACSLQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFNRRNLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVKVTKDCLHKAISVCAPGMEYKKIGKTIQDHADRYNYGVVRQFVGHGIGRVFHADPVVLHYSNYPELYRSSILFLV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccccccccEEEEEEEEEEccEEcccccEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccEEEccccccccccccccccccccccccccccccccEEEc
*******LQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFN*********RRRKRLRPGKVSPHRPVPDHIPRPPYVNSQK***IV****VHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVKVTKDCLHKAISVCAPGMEYKKIGKTIQDHADRYNYGVVRQFVGHGIGRVFHADPVVLHYSNYPELYRSSILFLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGGACSLQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFNRRNLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVKVTKDCLHKAISVCAPGMEYKKIGKTIQDHADRYNYGVVRQFVGHGIGRVFHADPVVLHYSNYPELYRSSILFLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methionine aminopeptidase 1D, chloroplastic/mitochondrial Removes the N-terminal methionine from nascent proteins.confidentQ9FV50
Methionine aminopeptidase 2 Removes the N-terminal methionine from nascent proteins, when the penultimate amino acid is alanine or proline, but enzyme activity is remarkably low when the second residue is phenylalanine or leucine. With glycine at the second position, Map is more active with a tetrapeptide than with a tripeptide.probableP0A5J2
Methionine aminopeptidase Removes the N-terminal methionine from nascent proteins.probableP0A5J3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.11.-Aminopeptidases.probable
3.4.11.18Methionyl aminopeptidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S6B, chain A
Confidence level:very confident
Coverage over the Query: 68-304
View the alignment between query and template
View the model in PyMOL
Template: 2BWW, chain A
Confidence level:probable
Coverage over the Query: 41-246
View the alignment between query and template
View the model in PyMOL