Query         022002
Match_columns 304
No_of_seqs    35 out of 37
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 07:16:51 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/022002.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/022002hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3966 p53-mediated apoptosis  40.1      21 0.00045   35.5   2.3   24  186-209   131-154 (360)
  2 KOG4686 Predicted sugar transp  36.3      31 0.00068   35.2   2.9   42  201-246   349-396 (459)
  3 PF11137 DUF2909:  Protein of u  33.3      57  0.0012   25.3   3.3   53  125-192     6-60  (63)
  4 PF12794 MscS_TM:  Mechanosensi  30.3      66  0.0014   31.1   4.0   78  112-191   127-219 (340)
  5 PF07123 PsbW:  Photosystem II   29.4      45 0.00096   29.7   2.4   29  247-277    95-123 (138)
  6 PF11014 DUF2852:  Protein of u  27.6      72  0.0016   27.6   3.3   28  252-279     3-30  (115)
  7 PLN00082 photosystem II reacti  24.7      65  0.0014   25.7   2.3   28  247-276    23-50  (67)
  8 PF15348 GEMIN8:  Gemini of Caj  21.4      55  0.0012   30.4   1.6   24  212-235   184-207 (209)
  9 PLN00077 photosystem II reacti  20.5      82  0.0018   27.8   2.3   28  247-276    84-111 (128)
 10 PF01788 PsbJ:  PsbJ;  InterPro  18.7      66  0.0014   23.4   1.2   22  115-136     7-31  (40)

No 1  
>KOG3966 consensus p53-mediated apoptosis protein EI24/PIG8 [Signal transduction mechanisms; Defense mechanisms]
Probab=40.12  E-value=21  Score=35.53  Aligned_cols=24  Identities=21%  Similarity=0.310  Sum_probs=14.7

Q ss_pred             hcccCccCCCCCchhHHHHHHHHH
Q 022002          186 GSQKGFLQPQLPFIPFAVLLGPYL  209 (304)
Q Consensus       186 gv~~g~~gP~l~f~~~~v~L~PYL  209 (304)
                      ++.|||++|++..+-..+-..|.+
T Consensus       131 ~~vw~wl~~~ls~lfg~iwVlPiF  154 (360)
T KOG3966|consen  131 NVVWGWLHPILSLLFGYIWVLPIF  154 (360)
T ss_pred             cchHhhhhHHHHHHHHHHHHHHHH
Confidence            478899998554444444444444


No 2  
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism]
Probab=36.34  E-value=31  Score=35.15  Aligned_cols=42  Identities=19%  Similarity=0.461  Sum_probs=32.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcCCceeeeeeeeh------hhHHHHHHH
Q 022002          201 FAVLLGPYLLLLSIQILTEMLTWHWQSPVWLVTPVVY------ESYRVLQLM  246 (304)
Q Consensus       201 ~~v~L~PYLvgL~VQia~E~lt~~~kSPVWpvVPvIY------evYRl~QL~  246 (304)
                      +...+-||..++..-..+-+++    -.-||+||.+-      +.|-+-|=.
T Consensus       349 ~Ft~lsPy~~m~~lGLsysllA----cslWP~va~~vpE~qLGTaygf~qsI  396 (459)
T KOG4686|consen  349 FFTFLSPYTSMTFLGLSYSLLA----CSLWPCVASLVPEEQLGTAYGFIQSI  396 (459)
T ss_pred             HhhhccHHHHHHHHhhhHHHHH----HHHhhhhhhhCCHHHhcchHHHHHHH
Confidence            4667789998888888888887    55699999875      356666653


No 3  
>PF11137 DUF2909:  Protein of unknown function (DUF2909);  InterPro: IPR021313  This is a family of proteins conserved in Proteobacteria of unknown function. 
Probab=33.33  E-value=57  Score=25.32  Aligned_cols=53  Identities=23%  Similarity=0.355  Sum_probs=32.6

Q ss_pred             hHhhcchhhhhhHHHHHhhhcccccccCCCccCCCCCCCCcchhhhhhhhh--hhHHhHHhhhhcccCcc
Q 022002          125 ILLGTDCIFNIGATLFLLMADSCARSKNTTRACNSKPPFSYKFWNMVANTT--GFIIPLLMLFGSQKGFL  192 (304)
Q Consensus       125 vLlgtealFyiGatlFLlmaD~~~Rp~~~~~~~~~~~P~syk~W~~~~~il--G~viPlv~m~gv~~g~~  192 (304)
                      +++..=.+|++|.++|+++-|+. +              +.|.....+.=+  +.++=++.+++.+.||+
T Consensus         6 v~lll~ii~sL~saL~~l~kd~~-~--------------~~rm~~~L~~RV~lS~~l~~lil~~~~~G~i   60 (63)
T PF11137_consen    6 VLLLLAIIASLFSALFFLVKDKG-S--------------SKRMVKALGRRVGLSALLFLLILIALYTGWI   60 (63)
T ss_pred             HHHHHHHHHHHHHHHHHHhhCCC-C--------------CchHHHHHHHHHHHHHHHHHHHHHHHHhCCC
Confidence            34466789999999999999943 1              112222222222  23444555668999998


No 4  
>PF12794 MscS_TM:  Mechanosensitive ion channel inner membrane domain 1
Probab=30.28  E-value=66  Score=31.10  Aligned_cols=78  Identities=19%  Similarity=0.254  Sum_probs=51.1

Q ss_pred             cccchhhhhhhhHhHh-----------hcc----hhhhhhHHHHHhhhcccccccCCCccCCCCCCCCcchhhhhhhhhh
Q 022002          112 QFLKWPMWLLGPCILL-----------GTD----CIFNIGATLFLLMADSCARSKNTTRACNSKPPFSYKFWNMVANTTG  176 (304)
Q Consensus       112 ~~~k~plWLlGPsvLl-----------gte----alFyiGatlFLlmaD~~~Rp~~~~~~~~~~~P~syk~W~~~~~ilG  176 (304)
                      +.+||-.|.+-|.+.+           ..|    ..|-++.....++.-+..|+..+...-  ++..+.+....+.....
T Consensus       127 ~~l~~~~~~~~pl~~~~~~~~~~~~~~~~d~LGrl~~ii~~~~l~~~~~~l~~~~~~~~~~--~~~~~~~~~~~l~~~~l  204 (340)
T PF12794_consen  127 RQLRWLIWVLVPLLFISIFAENLPDGLARDVLGRLAFIILLLLLAVFLWRLLRPGWGLYQP--KPDSWIHRLRYLWWPLL  204 (340)
T ss_pred             HHHHHHHHHHHHHHHHHHHhccCchhhhhhhHHHHHHHHHHHHHHHHHHHHHccccccccC--CCcchhHHHHHHHHHHH
Confidence            5688999999999888           111    223333333334444566666555222  44456666777777778


Q ss_pred             hHHhHHhhhhcccCc
Q 022002          177 FIIPLLMLFGSQKGF  191 (304)
Q Consensus       177 ~viPlv~m~gv~~g~  191 (304)
                      .++|++..+.+..||
T Consensus       205 i~~Pl~li~la~~GY  219 (340)
T PF12794_consen  205 ILAPLALIVLALLGY  219 (340)
T ss_pred             HHHHHHHHHHHHHhH
Confidence            899999999888898


No 5  
>PF07123 PsbW:  Photosystem II reaction centre W protein (PsbW);  InterPro: IPR009806 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbW found in PSII, where it is a subunit of the oxygen-evolving complex. PsbW appears to have several roles, including guiding PSII biogenesis and assembly, stabilising dimeric PSII [], and facilitating PSII repair after photo-inhibition []. There appears to be two classes of PsbW, class 1 being found predominantly in algae and cyanobacteria, and class 2 being found predominantly in plants. This entry represents class 2 PsbW.; GO: 0015979 photosynthesis, 0009507 chloroplast, 0009523 photosystem II
Probab=29.40  E-value=45  Score=29.72  Aligned_cols=29  Identities=38%  Similarity=0.685  Sum_probs=24.6

Q ss_pred             hhcccccccccchHHHHHhhhHHHHHHHHHH
Q 022002          247 RGLKLGAELSAPAWIVHTVRGLVCWWILILG  277 (304)
Q Consensus       247 RglqLv~~l~al~wv~~~i~GLvc~W~L~lg  277 (304)
                      -|+.|+-+++.+.|++..+-||+  |.||+-
T Consensus        95 TGL~lGlsn~~LgwIL~gVf~lI--WslY~~  123 (138)
T PF07123_consen   95 TGLPLGLSNNLLGWILLGVFGLI--WSLYFV  123 (138)
T ss_pred             ccccccccCchhHHHHHHHHHHH--HHHHHh
Confidence            48899999999999999988875  888753


No 6  
>PF11014 DUF2852:  Protein of unknown function (DUF2852);  InterPro: IPR021273  This bacterial family of proteins has no known function. 
Probab=27.60  E-value=72  Score=27.56  Aligned_cols=28  Identities=32%  Similarity=0.573  Sum_probs=23.5

Q ss_pred             ccccccchHHHHHhhhHHHHHHHHHHHH
Q 022002          252 GAELSAPAWIVHTVRGLVCWWILILGVQ  279 (304)
Q Consensus       252 v~~l~al~wv~~~i~GLvc~W~L~lg~q  279 (304)
                      +++-+-|+|+.-||.|.+.+|-+-|+|-
T Consensus         3 l~~~~~~a~Ia~mVlGFi~fWPlGla~L   30 (115)
T PF11014_consen    3 LDPRWKPAWIAAMVLGFIVFWPLGLALL   30 (115)
T ss_pred             cCCCCchHHHHHHHHHHHHHHHHHHHHH
Confidence            4566789999999999999999876653


No 7  
>PLN00082 photosystem II reaction centre W protein (PsbW); Provisional
Probab=24.66  E-value=65  Score=25.67  Aligned_cols=28  Identities=36%  Similarity=0.737  Sum_probs=23.1

Q ss_pred             hhcccccccccchHHHHHhhhHHHHHHHHH
Q 022002          247 RGLKLGAELSAPAWIVHTVRGLVCWWILIL  276 (304)
Q Consensus       247 RglqLv~~l~al~wv~~~i~GLvc~W~L~l  276 (304)
                      -|+.|+-+++.+.|++..+-+++  |.+|.
T Consensus        23 tGl~lGls~~~LgwIL~gvf~li--w~ly~   50 (67)
T PLN00082         23 TGLGLGVSNGKLTWILVGVTALI--WALYF   50 (67)
T ss_pred             ccccccccCchhhhHHHHHHHHH--HHHHh
Confidence            47888889999999999888774  88764


No 8  
>PF15348 GEMIN8:  Gemini of Cajal bodies-associated protein 8
Probab=21.42  E-value=55  Score=30.43  Aligned_cols=24  Identities=21%  Similarity=0.282  Sum_probs=22.2

Q ss_pred             HHHHHHHHHHhhhcCCceeeeeee
Q 022002          212 LSIQILTEMLTWHWQSPVWLVTPV  235 (304)
Q Consensus       212 L~VQia~E~lt~~~kSPVWpvVPv  235 (304)
                      -.+|+.|++.-...+..-||+||.
T Consensus       184 aalql~fd~~~D~~~P~~WP~IPL  207 (209)
T PF15348_consen  184 AALQLSFDKHCDRKQPKYWPVIPL  207 (209)
T ss_pred             HHHHHHHHhhhcccCCCCCCCCCC
Confidence            478999999999999999999996


No 9  
>PLN00077 photosystem II reaction centre W protein; Provisional
Probab=20.55  E-value=82  Score=27.79  Aligned_cols=28  Identities=39%  Similarity=0.718  Sum_probs=23.5

Q ss_pred             hhcccccccccchHHHHHhhhHHHHHHHHH
Q 022002          247 RGLKLGAELSAPAWIVHTVRGLVCWWILIL  276 (304)
Q Consensus       247 RglqLv~~l~al~wv~~~i~GLvc~W~L~l  276 (304)
                      -|+.|+-.++.+.|++..+-||+  |.+|+
T Consensus        84 tGl~lGlsn~~LgwIL~gVf~li--w~ly~  111 (128)
T PLN00077         84 TGLSLGLSNNLLGWILLGVFGLI--WSLYT  111 (128)
T ss_pred             ccccccccCchhhHHHHhHHHHH--HHHHh
Confidence            47888999999999999888875  88865


No 10 
>PF01788 PsbJ:  PsbJ;  InterPro: IPR002682 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbJ found in PSII. PsbJ is one of the most hydrophobic proteins in the thylakoid membrane, and is located in a gene cluster with PsbE, PsbF and PsbL (PsbEFJL). Both PsbJ and PsbL (IPR003372 from INTERPRO) are essential for proper assembly of the OEC. Mutations in PsbJ cause the light-harvesting antenna to remain detached from the PSII dimers []. In addition, both PsbJ and PsbL are involved in the unidirectional flow of electrons, where PsbJ regulates the forward electron flow from D2 (Qa) to the plastoquinone pool, and PsbL prevents the reduction of PSII by back electron flow from plastoquinol protecting PSII from photo-inactivation [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_J 3ARC_J 3A0B_J 3KZI_J 2AXT_J 3PRQ_J 4FBY_b 3BZ2_J 1S5L_j 3PRR_J ....
Probab=18.70  E-value=66  Score=23.40  Aligned_cols=22  Identities=32%  Similarity=0.736  Sum_probs=12.4

Q ss_pred             chhhhhhhhHhHh---hcchhhhhh
Q 022002          115 KWPMWLLGPCILL---GTDCIFNIG  136 (304)
Q Consensus       115 k~plWLlGPsvLl---gtealFyiG  136 (304)
                      +-|+||+|-..=+   ++=.+||.|
T Consensus         7 RIPLWlVgtv~G~~vi~lvglFfYG   31 (40)
T PF01788_consen    7 RIPLWLVGTVAGIAVIGLVGLFFYG   31 (40)
T ss_dssp             SS-HHHHHHHHHHHHHHHHHHHHHC
T ss_pred             cccchHHHHHHHHHHHHHHHHheec
Confidence            4599998865432   444455554


Done!