Citrus Sinensis ID: 022004


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MAPGGSACKEVVESDHTVINYDIKAESNTALTKTSFGLGGKQGIYSNNGVHELLECPVCTNLMYPPIHQCPNGHTLCSNCKNRVHNCCPTCRFDLGNIRCLALEKVAESLELPCKYQSLGCHDIFPYYGKLKHEQHCRFRPYNCPYAGSECSVTGDIPTLVAHLKDDHQVDMHDGCTFNHRYVKSDPNEVENATWMLTVFNCFGRQFCLHFEAFQLGMALVYMAFLRFMGDDDEAKKFSYSLEVGAHGRRLIWQGIPRSIRDSHRKVRDSQDGLIIQRNMALYFSGGDRTELKLRITGRIWKEE
cccccccccccccccccccccccccccccccccccccccccccccccccccccCCcccccccccccEEEcccccEEccccccccccccccccccccccccHHHHHHHHcccccccccccccCEEECcccccccccccccccccccccccccCEcccHHHHHHHHHHccccccCCcCEEEEEEEEcccccccccEEEEEEEECccCEEEEEEEEEEcccEEEEEEEEEECcccccccccEEEEEEEEcccEEEEEEEEEEEEccccccccccccEEEccccccccccccCEEEEEEEEEEEEEcc
***********************************************NGVHELLECPVCTNLMYPPIHQCPNGHTLCSNCKNRVHNCCPTCRFDLGNIRCLALEKVAESLELPCKYQSLGCHDIFPYYGKLKHEQHCRFRPYNCPYAGSECSVTGDIPTLVAHLKDDHQVDMHDGCTFNHRYVKSDPNEVENATWMLTVFNCFGRQFCLHFEAFQLGMALVYMAFLRFMGDDDEAKKFSYSLEVGAHGRRLIWQGIPRSIR*****VRDSQDGLIIQRNMALYFSGGDRTELKLRITGRIWK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPGGSACKEVVESDHTVINYDIKAESNTALTKTSFGLGGKQGIYSNNGVHELLECPVCTNLMYPPIHQCPNGHTLCSNCKNRVHNCCPTCRFDLGNIRCLALEKVAESLELPCKYQSLGCHDIFPYYGKLKHEQHCRFRPYNCPYAGSECSVTGDIPTLVAHLKDDHQVDMHDGCTFNHRYVKSDPNEVENATWMLTVFNCFGRQFCLHFEAFQLGMALVYMAFLRFMGDDDEAKKFSYSLEVGAHGRRLIWQGIPRSIRDSHRKVRDSQDGLIIQRNMALYFSGGDRTELKLRITGRIWKEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase SINAT2 E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates.confidentQ9M2P4
Probable E3 ubiquitin-protein ligase sinah E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. The adapter phyl is required to direct the degradation of the two isoforms of the transcriptional repressor Tramtrack (Ttk). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates. A phyl-independent mechanism of degradation exists for isoform beta of ttk that involves motifs in the C-terminus of ttk.probableQ8T3Y0
E3 ubiquitin-protein ligase SIAH1A E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Required for completion of meiosis I in males. Induces apoptosis in cooperation with PEG3. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.probableP61092

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A25, chain A
Confidence level:very confident
Coverage over the Query: 141-297
View the alignment between query and template
View the model in PyMOL
Template: 3HCS, chain A
Confidence level:very confident
Coverage over the Query: 43-171
View the alignment between query and template
View the model in PyMOL