Query         022015
Match_columns 304
No_of_seqs    50 out of 52
Neff          3.2 
Searched_HMMs 46136
Date          Fri Mar 29 07:22:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/022015.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/022015hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05708 DUF830:  Orthopoxvirus  95.8   0.018 3.9E-07   47.7   5.3   46  225-274     2-47  (158)
  2 PRK10030 hypothetical protein;  93.8    0.13 2.9E-06   46.3   5.6   48  223-275    19-66  (197)
  3 PRK11470 hypothetical protein;  92.4    0.31 6.8E-06   44.7   5.9   58  222-286     6-64  (200)
  4 PRK11479 hypothetical protein;  86.5     0.7 1.5E-05   44.4   3.5   50  218-275    58-107 (274)
  5 PF01436 NHL:  NHL repeat;  Int  76.7     3.3 7.1E-05   26.3   2.9   17  259-276     6-22  (28)
  6 PF05257 CHAP:  CHAP domain;  I  76.0     6.6 0.00014   31.7   5.2   46  220-279    58-104 (124)
  7 PF07646 Kelch_2:  Kelch motif;  67.6     5.7 0.00012   27.3   2.6   20  253-275     1-20  (49)
  8 PF05382 Amidase_5:  Bacterioph  59.7      16 0.00034   32.2   4.5   28  223-262    74-101 (145)
  9 PF13418 Kelch_4:  Galactose ox  57.1      11 0.00024   25.5   2.5   18  253-272     1-18  (49)
 10 PF01344 Kelch_1:  Kelch motif;  51.5      17 0.00037   24.1   2.7   22  253-277     1-22  (47)
 11 TIGR02219 phage_NlpC_fam putat  47.0      32 0.00068   28.9   4.1   35  219-269    71-105 (134)
 12 PRK15231 fimbrial adhesin prot  41.5      21 0.00045   32.1   2.3   48  223-272    47-99  (150)
 13 cd03531 Rieske_RO_Alpha_KSH Th  39.9      38 0.00082   27.6   3.5   38  221-277     7-44  (115)
 14 PF07494 Reg_prop:  Two compone  38.8      29 0.00062   21.4   2.0   11  262-272    11-21  (24)
 15 cd04337 Rieske_RO_Alpha_Cao Ca  38.3      56  0.0012   27.3   4.3   41  215-274    17-57  (129)
 16 cd03477 Rieske_YhfW_C YhfW fam  36.4 1.1E+02  0.0025   24.1   5.6   43  222-283     5-47  (91)
 17 PF07313 DUF1460:  Protein of u  36.3      60  0.0013   30.3   4.6   50  222-285   151-200 (216)
 18 cd03474 Rieske_T4moC Toluene-4  35.9   1E+02  0.0023   24.2   5.3   44  221-283     6-49  (108)
 19 PF13964 Kelch_6:  Kelch motif   35.8      54  0.0012   22.3   3.3   21  254-277     2-22  (50)
 20 COG5008 PilU Tfp pilus assembl  35.5      22 0.00048   35.6   1.7  108  147-262   110-231 (375)
 21 PF09713 A_thal_3526:  Plant pr  32.8      11 0.00025   28.5  -0.6   38  167-204    12-51  (54)
 22 PF09652 Cas_VVA1548:  Putative  32.5      31 0.00066   28.8   1.8   32  196-232     8-39  (93)
 23 smart00739 KOW KOW (Kyprides,   31.5      91   0.002   18.7   3.4   23  225-263     2-24  (28)
 24 PF00877 NLPC_P60:  NlpC/P60 fa  30.3      35 0.00076   26.6   1.8   37  219-275    46-82  (105)
 25 PF14133 DUF4300:  Domain of un  28.4      47   0.001   31.7   2.6   25  254-279   185-209 (250)
 26 PF13854 Kelch_5:  Kelch motif   28.2      64  0.0014   21.7   2.6   17  253-272     4-20  (42)
 27 PF01904 DUF72:  Protein of unk  27.5 2.4E+02  0.0051   25.7   6.8   82  160-242    84-178 (230)
 28 cd09011 Glo_EDI_BRP_like_23 Th  27.1      71  0.0015   24.5   3.0   19  256-274   100-118 (120)
 29 cd03467 Rieske Rieske domain;   26.9   2E+02  0.0044   21.9   5.5   45  221-284     6-50  (98)
 30 PF04473 DUF553:  Transglutamin  24.6      65  0.0014   28.5   2.6   19  256-275   109-127 (153)
 31 TIGR02604 Piru_Ver_Nterm putat  24.3      60  0.0013   31.1   2.5   17  258-275    17-33  (367)
 32 TIGR01589 A_thal_3526 uncharac  23.9      19 0.00042   27.6  -0.7   38  167-204    15-54  (57)
 33 cd03480 Rieske_RO_Alpha_PaO Ri  23.7   1E+02  0.0022   26.0   3.5   41  216-275    18-59  (138)
 34 TIGR03081 metmalonyl_epim meth  23.7      60  0.0013   24.6   2.0   15  256-270   108-124 (128)
 35 cd03469 Rieske_RO_Alpha_N Ries  23.3 1.2E+02  0.0025   24.0   3.6   35  222-275     7-42  (118)
 36 cd03532 Rieske_RO_Alpha_VanA_D  23.2      98  0.0021   25.0   3.2   40  216-275     6-45  (116)
 37 cd03422 YedF YedF is a bacteri  22.3 2.2E+02  0.0048   21.3   4.8   45  223-272    21-65  (69)
 38 PF13629 T2SS-T3SS_pil_N:  Pilu  21.6      97  0.0021   23.4   2.7   42  225-273    26-68  (72)
 39 TIGR03047 PS_II_psb28 photosys  20.8 1.5E+02  0.0032   25.6   3.9   54  231-292    27-82  (109)
 40 PF14288 FKS1_dom1:  1,3-beta-g  20.5      31 0.00067   29.6  -0.2   75  178-264     7-97  (117)
 41 cd03538 Rieske_RO_Alpha_AntDO   20.4 1.4E+02  0.0031   25.5   3.8   41  216-275    23-64  (146)
 42 smart00788 Adenylsucc_synt Ade  20.3      44 0.00096   34.1   0.8   34  243-279    25-60  (421)
 43 PF09916 DUF2145:  Uncharacteri  20.3 1.4E+02  0.0031   28.0   4.0   46  228-293     8-53  (201)
 44 cd08357 Glo_EDI_BRP_like_18 Th  20.2   1E+02  0.0022   23.2   2.6   18  254-271   104-121 (125)

No 1  
>PF05708 DUF830:  Orthopoxvirus protein of unknown function (DUF830); PDB: 2IF6_B 3KW0_C.
Probab=95.82  E-value=0.018  Score=47.75  Aligned_cols=46  Identities=17%  Similarity=0.266  Sum_probs=35.5

Q ss_pred             CCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEec
Q 022015          225 IHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGES  274 (304)
Q Consensus       225 IhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES  274 (304)
                      .|+||.|...--    +.+...++=+|++..||.+|.+++.+++.||+|+
T Consensus         2 l~~GDIil~~~~----~~~s~~i~~~t~~~~~HvgI~~~~~~~~~~viea   47 (158)
T PF05708_consen    2 LQTGDIILTRGK----SSLSKAIRPVTSSPYSHVGIVIGDEGQEPYVIEA   47 (158)
T ss_dssp             --TT-EEEEEE-----SCCHHHHHHHHTSS--EEEEEEEETTE-EEEEEE
T ss_pred             CCCeeEEEEECC----chHHHHHHHHhCCCCCEEEEEEecCCCceEEEEe
Confidence            589999988644    7789999999999999999999987778999999


No 2  
>PRK10030 hypothetical protein; Provisional
Probab=93.82  E-value=0.13  Score=46.25  Aligned_cols=48  Identities=17%  Similarity=0.113  Sum_probs=41.6

Q ss_pred             CcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEecc
Q 022015          223 EEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESG  275 (304)
Q Consensus       223 ~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~  275 (304)
                      .++|+||.|-.+--    +.....|+.+|++.-.|.++..+. +|+.+|+|+-
T Consensus        19 ~~l~~GDlif~~g~----~~~s~aI~~~T~s~~SHVGIi~~~-~~~~~ViEAv   66 (197)
T PRK10030         19 WQPQTGDIIFQISR----SSQSKAIQLATHSDYSHTGMIVKR-NKKPYVFEAV   66 (197)
T ss_pred             cCCCCCCEEEEeCC----CcHhHHHhHhhCCCCceEEEEEEE-CCcEEEEEec
Confidence            38899999988743    556899999999999999999985 8999999995


No 3  
>PRK11470 hypothetical protein; Provisional
Probab=92.42  E-value=0.31  Score=44.71  Aligned_cols=58  Identities=17%  Similarity=0.210  Sum_probs=43.4

Q ss_pred             CCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEeccCccccc-ccccc
Q 022015          222 VEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESGHENDEV-KLTDL  286 (304)
Q Consensus       222 ~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~~en~~~-~~~~~  286 (304)
                      +.++|+||.|-++--.+.   + -.|+.+||+...|..|..+-..++-+|+||-   +++ ++|.|
T Consensus         6 ~~~l~~GDLvF~~~~~~~---~-~aI~~aT~s~~sHvGII~~~~~~~~~VlEA~---~~~vr~TpL   64 (200)
T PRK11470          6 PAEYEIGDIVFTCIGAAL---F-GQISAASNCWSNHVGIIIGHNGEDFLVAESR---VPLSTVTTL   64 (200)
T ss_pred             cCCCCCCCEEEEeCCcch---h-HHHHhccCCccceEEEEEEEcCCceEEEEec---CCceEEeEH
Confidence            469999999998853222   3 3588899999999999995435689999994   344 55554


No 4  
>PRK11479 hypothetical protein; Provisional
Probab=86.49  E-value=0.7  Score=44.37  Aligned_cols=50  Identities=24%  Similarity=0.337  Sum_probs=40.7

Q ss_pred             ccCCCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEecc
Q 022015          218 TNVTVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESG  275 (304)
Q Consensus       218 v~i~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~  275 (304)
                      ..|+.+++|+||.|....-    +.+.-.|++.|++...|.+|.+-  ||+  ++|+-
T Consensus        58 ~~Vs~~~LqpGDLVFfst~----t~~S~~Ik~~T~s~~SHVgIylG--dg~--vIEA~  107 (274)
T PRK11479         58 KEITAPDLKPGDLLFSSSL----GVTSFGIRVFSTSSVSHVAIYLG--ENN--VAEAT  107 (274)
T ss_pred             cccChhhCCCCCEEEEecC----CccccceecccCCCCcEEEEEec--CCe--EEEcC
Confidence            3678899999999997643    45677899999999999999994  454  78884


No 5  
>PF01436 NHL:  NHL repeat;  InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins. For example, the repeat is found in a variety of enzymes of the copper type II, ascorbate-dependent monooxygenase family which catalyse the C terminus alpha-amidation of biological peptides []. In many it occurs in tandem arrays, for example in the ringfinger beta-box, coiled-coil (RBCC) eukaryotic growth regulators []. The 'Brain Tumor' protein (Brat) is one such growth regulator that contains a 6-bladed NHL-repeat beta-propeller [, ].  The NHL repeats are also found in serine/threonine protein kinase (STPK) in diverse range of pathogenic bacteria. These STPK are transmembrane receptors with a intracellular N-terminal kinase domain and extracellular C-terminal sensor domain. In the STPK, PknD, from Mycobacterium tuberculosis, the sensor domain forms a rigid, six-bladed b-propeller composed of NHL repeats with a flexible tether to the transmembrane domain.; GO: 0005515 protein binding; PDB: 3FVZ_A 3FW0_A 1RWL_A 1RWI_A 1Q7F_A.
Probab=76.74  E-value=3.3  Score=26.33  Aligned_cols=17  Identities=41%  Similarity=0.915  Sum_probs=13.8

Q ss_pred             EEEEecCCCcEEEEeccC
Q 022015          259 AVCLRDSEGKLWVGESGH  276 (304)
Q Consensus       259 av~Lrd~dGeLwV~ES~~  276 (304)
                      -+|+ |++|++||+||+.
T Consensus         6 gvav-~~~g~i~VaD~~n   22 (28)
T PF01436_consen    6 GVAV-DSDGNIYVADSGN   22 (28)
T ss_dssp             EEEE-ETTSEEEEEECCC
T ss_pred             EEEE-eCCCCEEEEECCC
Confidence            4677 6899999999765


No 6  
>PF05257 CHAP:  CHAP domain;  InterPro: IPR007921 The CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain is a region between 110 and 140 amino acids that is found in proteins from bacteria, bacteriophages, archaea and eukaryotes of the Trypanosomidae family. Many of these proteins are uncharacterised, but it has been proposed that they may function mainly in peptidoglycan hydrolysis. The CHAP domain is found in a wide range of protein architectures; it is commonly associated with bacterial type SH3 domains and with several families of amidase domains. It has been suggested that CHAP domain containing proteins utilise a catalytic cysteine residue in a nucleophilic-attack mechanism [, ]. The CHAP domain contains two invariant residues, a cysteine and a histidine. These residues form part of the putative active site of CHAP domain containing proteins. Secondary structure predictions show that the CHAP domain belongs to the alpha + beta structural class, with the N-terminal half largely containing predicted alpha helices and the C-terminal half principally composed of predicted beta strands [, ]. Some proteins known to contain a CHAP domain are listed below:   Bacterial and trypanosomal glutathionylspermidine amidases.  A variety of bacterial autolysins.  A Nocardia aerocolonigenes putative esterase.  Streptococcus pneumoniae choline-binding protein D.  Methanosarcina mazei protein MM2478, a putative chloride channel.  Several phage-encoded peptidoglycan hydrolases.  Cysteine peptidases belonging to MEROPS peptidase family C51 (D-alanyl-glycyl endopeptidase, clan CA).  ; PDB: 2LRJ_A 2VPM_B 2VOB_B 2VPS_A 2K3A_A 2IO9_A 2IO8_A 2IOB_A 2IOA_B 2IO7_B ....
Probab=76.02  E-value=6.6  Score=31.66  Aligned_cols=46  Identities=24%  Similarity=0.208  Sum_probs=33.5

Q ss_pred             CCCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEec-CCCcEEEEeccCccc
Q 022015          220 VTVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRD-SEGKLWVGESGHEND  279 (304)
Q Consensus       220 i~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd-~dGeLwV~ES~~en~  279 (304)
                      -.....++||.+...              ..++...||+++.... .+|.+.++|.-..+.
T Consensus        58 ~~~~~P~~Gdivv~~--------------~~~~~~~GHVaIV~~v~~~~~i~v~e~N~~~~  104 (124)
T PF05257_consen   58 STGSTPQPGDIVVWD--------------SGSGGGYGHVAIVESVNDGGTITVIEQNWGNG  104 (124)
T ss_dssp             EECS---TTEEEEEE--------------ECTTTTT-EEEEEEEE-TTSEEEEEECSSTBS
T ss_pred             ccCcccccceEEEec--------------cCCCCCCCeEEEEEEECCCCEEEEEECCcCCC
Confidence            345677899988875              4567889999999988 779999999986543


No 7  
>PF07646 Kelch_2:  Kelch motif;  InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []. This sequence motif represents one beta-sheet blade, and several of these repeats can associate to form a beta-propeller. For instance, the motif appears 6 times in Drosophila egg-chamber regulatory protein, creating a 6-bladed beta-propeller. The motif is also found in mouse protein MIPP [] and in a number of poxviruses. In addition, kelch repeats have been recognised in alpha- and beta-scruin [, ], and in galactose oxidase from the fungus Dactylium dendroides [, ]. The structure of galactose oxidase reveals that the repeated sequence corresponds to a 4-stranded anti-parallel beta-sheet motif that forms the repeat unit in a super-barrel structural fold []. The known functions of kelch-containing proteins are diverse: scruin is an actin cross-linking protein; galactose oxidase catalyses the oxidation of the hydroxyl group at the C6 position in D-galactose; neuraminidase hydrolyses sialic acid residues from glycoproteins; and kelch may have a cytoskeletal function, as it is localised to the actin-rich ring canals that connect the 15 nurse cells to the developing oocyte in Drosophila []. Nevertheless, based on the location of the kelch pattern in the catalytic unit in galactose oxidase, functionally important residues have been predicted in glyoxal oxidase []. This entry represents a type of kelch sequence motif that comprises one beta-sheet blade.; GO: 0005515 protein binding
Probab=67.63  E-value=5.7  Score=27.33  Aligned_cols=20  Identities=40%  Similarity=0.557  Sum_probs=16.0

Q ss_pred             cCcceeEEEEecCCCcEEEEecc
Q 022015          253 AYAGHTAVCLRDSEGKLWVGESG  275 (304)
Q Consensus       253 A~aGHTav~Lrd~dGeLwV~ES~  275 (304)
                      .+.||+++++   |+||||+=--
T Consensus         1 ~r~~hs~~~~---~~kiyv~GG~   20 (49)
T PF07646_consen    1 PRYGHSAVVL---DGKIYVFGGY   20 (49)
T ss_pred             CccceEEEEE---CCEEEEECCc
Confidence            3689999988   7999997433


No 8  
>PF05382 Amidase_5:  Bacteriophage peptidoglycan hydrolase ;  InterPro: IPR008044 This entry is represented by Bacteriophage SFi21, lysin (Cell wall hydrolase; 3.5.1.28 from EC). At least one of proteins in this entry, the Pal protein from the pneumococcal bacteriophage Dp-1 (O03979 from SWISSPROT) has been shown to be an N-acetylmuramoyl-L-alanine amidase []. According to the known modular structure of this and other peptidoglycan hydrolases from the pneumococcal system, the active site should reside within this domain while a C-terminal domain binds to the choline residues of the cell wall teichoic acids [, ].
Probab=59.74  E-value=16  Score=32.16  Aligned_cols=28  Identities=21%  Similarity=0.482  Sum_probs=21.3

Q ss_pred             CcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEE
Q 022015          223 EEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCL  262 (304)
Q Consensus       223 ~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~L  262 (304)
                      .++|.||.+...+- |.           ++...|||.|++
T Consensus        74 ~~~q~GDI~I~g~~-g~-----------S~G~~GHtgif~  101 (145)
T PF05382_consen   74 WNLQRGDIFIWGRR-GN-----------SAGAGGHTGIFM  101 (145)
T ss_pred             ccccCCCEEEEcCC-CC-----------CCCCCCeEEEEe
Confidence            37999999986543 32           455689999999


No 9  
>PF13418 Kelch_4:  Galactose oxidase, central domain; PDB: 2UVK_B.
Probab=57.08  E-value=11  Score=25.49  Aligned_cols=18  Identities=28%  Similarity=0.516  Sum_probs=12.3

Q ss_pred             cCcceeEEEEecCCCcEEEE
Q 022015          253 AYAGHTAVCLRDSEGKLWVG  272 (304)
Q Consensus       253 A~aGHTav~Lrd~dGeLwV~  272 (304)
                      ++.||+++.+  .++++||.
T Consensus         1 pR~~h~~~~~--~~~~i~v~   18 (49)
T PF13418_consen    1 PRYGHSAVSI--GDNSIYVF   18 (49)
T ss_dssp             --BS-EEEEE---TTEEEEE
T ss_pred             CcceEEEEEE--eCCeEEEE
Confidence            4789999998  36899986


No 10 
>PF01344 Kelch_1:  Kelch motif;  InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []. This sequence motif represents one beta-sheet blade, and several of these repeats can associate to form a beta-propeller. For instance, the motif appears 6 times in Drosophila egg-chamber regulatory protein, creating a 6-bladed beta-propeller. The motif is also found in mouse protein MIPP [] and in a number of poxviruses. In addition, kelch repeats have been recognised in alpha- and beta-scruin [, ], and in galactose oxidase from the fungus Dactylium dendroides [, ]. The structure of galactose oxidase reveals that the repeated sequence corresponds to a 4-stranded anti-parallel beta-sheet motif that forms the repeat unit in a super-barrel structural fold []. The known functions of kelch-containing proteins are diverse: scruin is an actin cross-linking protein; galactose oxidase catalyses the oxidation of the hydroxyl group at the C6 position in D-galactose; neuraminidase hydrolyses sialic acid residues from glycoproteins; and kelch may have a cytoskeletal function, as it is localised to the actin-rich ring canals that connect the 15 nurse cells to the developing oocyte in Drosophila []. Nevertheless, based on the location of the kelch pattern in the catalytic unit in galactose oxidase, functionally important residues have been predicted in glyoxal oxidase []. This entry represents a type of kelch sequence motif that comprises one beta-sheet blade.; GO: 0005515 protein binding; PDB: 2XN4_A 2WOZ_A 3II7_A 4ASC_A 1U6D_X 1ZGK_A 2FLU_X 2VPJ_A 2DYH_A 1X2R_A ....
Probab=51.53  E-value=17  Score=24.08  Aligned_cols=22  Identities=27%  Similarity=0.368  Sum_probs=17.1

Q ss_pred             cCcceeEEEEecCCCcEEEEeccCc
Q 022015          253 AYAGHTAVCLRDSEGKLWVGESGHE  277 (304)
Q Consensus       253 A~aGHTav~Lrd~dGeLwV~ES~~e  277 (304)
                      ++++|+++.+   ++++||+=-..+
T Consensus         1 pR~~~~~~~~---~~~iyv~GG~~~   22 (47)
T PF01344_consen    1 PRSGHAAVVV---GNKIYVIGGYDG   22 (47)
T ss_dssp             -BBSEEEEEE---TTEEEEEEEBES
T ss_pred             CCccCEEEEE---CCEEEEEeeecc
Confidence            4689999998   799999865554


No 11 
>TIGR02219 phage_NlpC_fam putative phage cell wall peptidase, NlpC/P60 family. Members of this family show sequence similarity to members of the NlpC/P60 family described by Pfam model pfam00877 and by Anantharaman and Aravind (PubMed:12620121). The NlpC/P60 family includes a number of characterized bacterial cell wall hydrolases. Members of this related family are all found in prophage regions of bacterial genomes.
Probab=46.97  E-value=32  Score=28.90  Aligned_cols=35  Identities=26%  Similarity=0.391  Sum_probs=25.5

Q ss_pred             cCCCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcE
Q 022015          219 NVTVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKL  269 (304)
Q Consensus       219 ~i~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeL  269 (304)
                      .++.+++|+||++... .             ..|..++|..+.+ + +|++
T Consensus        71 ~v~~~~~qpGDlvff~-~-------------~~~~~~~HvGIy~-G-~g~~  105 (134)
T TIGR02219        71 PVPCDAAQPGDVLVFR-W-------------RPGAAAKHAAIAA-S-PTRF  105 (134)
T ss_pred             ccchhcCCCCCEEEEe-e-------------CCCCCCcEEEEEe-C-CCcE
Confidence            4566789999998653 3             2355688999999 3 6764


No 12 
>PRK15231 fimbrial adhesin protein SefD; Provisional
Probab=41.49  E-value=21  Score=32.12  Aligned_cols=48  Identities=17%  Similarity=0.204  Sum_probs=41.2

Q ss_pred             CcCCCCCEEEEEeecccCCchhhHHHhhc----CcCcceeEEE-EecCCCcEEEE
Q 022015          223 EEIHSGDFLAVSKIRGRWGGFETLEKWVT----GAYAGHTAVC-LRDSEGKLWVG  272 (304)
Q Consensus       223 ~DIhSGDFLaVsrirgrwdGfdtlikW~T----GA~aGHTav~-Lrd~dGeLwV~  272 (304)
                      +.+++|+.||-.||--| +||- +.||..    |..+||=.+- .+|+.-||+|-
T Consensus        47 ~~l~dg~~laTGri~cr-egfh-iwmns~~~q~gg~P~~YIvqGk~dsqh~LrVR   99 (150)
T PRK15231         47 DRITSNKIIGTGHLFNR-EGKK-ILISSSLEKIKNTPGAYIIRGQNNSAHKLRIR   99 (150)
T ss_pred             hhccCCcEEeeeeEEec-CCeE-EEEecchhhcCCCccEEEEECCCCCcceEEEE
Confidence            68999999999999888 7998 889987    8899998887 77777788873


No 13 
>cd03531 Rieske_RO_Alpha_KSH The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH).  The terminal oxygenase component of KSH is a key enzyme in the microbial steroid degradation pathway, catalyzing the 9 alpha-hydroxylation of 4-androstene-3,17-dione (AD) and 1,4-androstadiene-3,17-dione (ADD). KSH is a two-component class IA monooxygenase, with terminal oxygenase (KshA) and oxygenase reductase (KshB) components.  KSH activity has been found in many actino- and proteo- bacterial genera including Rhodococcus, Nocardia, Arthrobacter, Mycobacterium, and Burkholderia.
Probab=39.93  E-value=38  Score=27.58  Aligned_cols=38  Identities=24%  Similarity=0.269  Sum_probs=28.9

Q ss_pred             CCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEeccCc
Q 022015          221 TVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESGHE  277 (304)
Q Consensus       221 ~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~~e  277 (304)
                      ..+||..|+...+. +                  .|...+..|+.||++++++.-=-
T Consensus         7 ~~~dl~~g~~~~~~-~------------------~g~~i~l~r~~~g~~~a~~n~Cp   44 (115)
T cd03531           7 LARDFRDGKPHGVE-A------------------FGTKLVVFADSDGALNVLDAYCR   44 (115)
T ss_pred             EHHHCCCCCeEEEE-E------------------CCeEEEEEECCCCCEEEEcCcCC
Confidence            35778888888766 3                  25688889988999999987433


No 14 
>PF07494 Reg_prop:  Two component regulator propeller;  InterPro: IPR011110 A large group of two component regulator proteins appear to have the same N-terminal structure of 14 tandem repeats. These repeats show homology to members of IPR002372 from INTERPRO and IPR001680 from INTERPRO indicating that they are likely to form a beta-propeller. This family has been built with artificially high cut-offs in order to avoid overlaps with other beta-propeller families. The fourteen repeats are likely to form two propellers; it is not clear if these structures are likely to recruit other proteins or interact with DNA.; PDB: 3V9F_D 3VA6_B 3OTT_B 4A2M_D 4A2L_B.
Probab=38.80  E-value=29  Score=21.44  Aligned_cols=11  Identities=55%  Similarity=1.371  Sum_probs=8.3

Q ss_pred             EecCCCcEEEE
Q 022015          262 LRDSEGKLWVG  272 (304)
Q Consensus       262 Lrd~dGeLwV~  272 (304)
                      +.|.+|.|||+
T Consensus        11 ~~D~~G~lWig   21 (24)
T PF07494_consen   11 YEDSDGNLWIG   21 (24)
T ss_dssp             EE-TTSCEEEE
T ss_pred             EEcCCcCEEEE
Confidence            34888999997


No 15 
>cd04337 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) is a rieske non-heme iron-sulfur protein located within the plastid-envelope inner and thylakoid membranes, that catalyzes the conversion of chlorophyllide a to chlorophyllide b. CAO is found not only in plants but also in chlorophytes and  prochlorophytes. This domain represents the N-terminal rieske domain of the oxygenase alpha subunit. ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Cao is closely related to several other plant RO's including Tic 55, a 55 kDa protein associated with protein transport through the inner 
Probab=38.34  E-value=56  Score=27.30  Aligned_cols=41  Identities=15%  Similarity=0.295  Sum_probs=30.6

Q ss_pred             CccccCCCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEec
Q 022015          215 PWFTNVTVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGES  274 (304)
Q Consensus       215 p~~v~i~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES  274 (304)
                      -|..-...+||.+||...+. +                  .|...+..|+.||++++.+.
T Consensus        17 ~W~~v~~~~el~~g~~~~~~-v------------------~g~~l~l~r~~~g~v~A~~n   57 (129)
T cd04337          17 FWYPVEFSKDLKMDTMVPFE-L------------------FGQPWVLFRDEDGTPGCIRD   57 (129)
T ss_pred             ccEEEEEHHHCCCCCeEEEE-E------------------CCcEEEEEECCCCcEEEEeC
Confidence            36334456889999988775 3                  35577888988999999987


No 16 
>cd03477 Rieske_YhfW_C YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. It is commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes. YhfW is found in bacteria, some eukaryotes and archaea.
Probab=36.38  E-value=1.1e+02  Score=24.07  Aligned_cols=43  Identities=21%  Similarity=0.299  Sum_probs=30.3

Q ss_pred             CCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEeccCccccccc
Q 022015          222 VEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESGHENDEVKL  283 (304)
Q Consensus       222 ~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~~en~~~~~  283 (304)
                      .+||.+|+...+. +                  .|...+..|+.||++|+++..---....|
T Consensus         5 ~~dl~~g~~~~~~-~------------------~g~~v~v~r~~~g~~~A~~~~CpH~g~~l   47 (91)
T cd03477           5 IEDLAPGEGGVVN-I------------------GGKRLAVYRDEDGVLHTVSATCTHLGCIV   47 (91)
T ss_pred             hhhcCCCCeEEEE-E------------------CCEEEEEEECCCCCEEEEcCcCCCCCCCC
Confidence            4788999987664 4                  24566778888999999987654444433


No 17 
>PF07313 DUF1460:  Protein of unknown function (DUF1460);  InterPro: IPR010846 This family consists of several hypothetical bacterial proteins of around 260 residues in length. The function of this family is unknown.; PDB: 2P1G_B 2IM9_A.
Probab=36.25  E-value=60  Score=30.25  Aligned_cols=50  Identities=20%  Similarity=0.464  Sum_probs=33.3

Q ss_pred             CCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEeccCccccccccc
Q 022015          222 VEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESGHENDEVKLTD  285 (304)
Q Consensus       222 ~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~~en~~~~~~~  285 (304)
                      .+.||+||.++|..=.   +|+|          ..|+-++.|..|| |+....-....|.++.|
T Consensus       151 ~~~i~~GDiI~i~t~~---~GLD----------vsH~Giav~~~~~-l~l~hASs~~~~~~vvd  200 (216)
T PF07313_consen  151 LSQIKNGDIIAIVTNI---KGLD----------VSHVGIAVWKNDG-LHLRHASSLHKKVVVVD  200 (216)
T ss_dssp             HTTS-TT-EEEEEEEC---TTEC----------EEEEEEEEEETTE-EEEEEEETTTTEEEEEC
T ss_pred             HhcCCCCCEEEEEeCC---CCCc----------eeeEEEEEEECCe-EEEEeCCCCCCCcEEec
Confidence            4889999999987542   4554          6899999998555 88876555444444444


No 18 
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. T4mo is a four-protein complex that catalyzes the NADH- and O2-dependent hydroxylation of toluene to form p-cresol. T4mo consists of an NADH oxidoreductase (T4moF), a diiron hydroxylase (T4moH), a catalytic effector protein (T4moD), and a Rieske ferredoxin (T4moC). T4moC contains a Rieske domain and functions as an obligate electron carrier between T4moF and T4moH. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.
Probab=35.88  E-value=1e+02  Score=24.20  Aligned_cols=44  Identities=14%  Similarity=0.328  Sum_probs=29.9

Q ss_pred             CCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEeccCccccccc
Q 022015          221 TVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESGHENDEVKL  283 (304)
Q Consensus       221 ~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~~en~~~~~  283 (304)
                      ..+||..|+...+. +.                  |-..+++|+.+|++++.+..=--..+.|
T Consensus         6 ~~~~l~~g~~~~~~-~~------------------~~~~~~~~~~~g~~~A~~n~CpH~g~~L   49 (108)
T cd03474           6 SLDDVWEGEMELVD-VD------------------GEEVLLVAPEGGEFRAFQGICPHQEIPL   49 (108)
T ss_pred             ehhccCCCceEEEE-EC------------------CeEEEEEEccCCeEEEEcCcCCCCCCCc
Confidence            46789999988754 31                  2256788888999999886544333333


No 19 
>PF13964 Kelch_6:  Kelch motif
Probab=35.79  E-value=54  Score=22.31  Aligned_cols=21  Identities=33%  Similarity=0.457  Sum_probs=16.1

Q ss_pred             CcceeEEEEecCCCcEEEEeccCc
Q 022015          254 YAGHTAVCLRDSEGKLWVGESGHE  277 (304)
Q Consensus       254 ~aGHTav~Lrd~dGeLwV~ES~~e  277 (304)
                      +.+|+++++   +|+|||+=-...
T Consensus         2 R~~~s~v~~---~~~iyv~GG~~~   22 (50)
T PF13964_consen    2 RYGHSAVVV---GGKIYVFGGYDN   22 (50)
T ss_pred             CccCEEEEE---CCEEEEECCCCC
Confidence            678999887   789999844443


No 20 
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=35.55  E-value=22  Score=35.59  Aligned_cols=108  Identities=22%  Similarity=0.270  Sum_probs=76.4

Q ss_pred             Eeecccchhh--HHhhhcCeEEEEec--hhhHhHHHHHHhhccccCCC-----cccccccHHHHHHhcCCceeecCCC--
Q 022015          147 FNEWEGKLEY--EYVKNKGVSIFLMQ--AGMLGTLEALWDVFPLFTNT-----GWGENSNIGFLKKHMGASFEQRPEP--  215 (304)
Q Consensus       147 ~k~we~~ae~--e~Ik~~Gv~IFlm~--~G~~~TL~sL~dtlpLFsnt-----~WGe~~Nl~FLk~~mG~~fe~R~~p--  215 (304)
                      |.+++=++-+  -.+++.|+-||-=.  +|=.-|+-+.++-    .|.     .--...-++|+.+|-+--+..|+.-  
T Consensus       110 ~eeL~LPevlk~la~~kRGLviiVGaTGSGKSTtmAaMi~y----RN~~s~gHIiTIEDPIEfih~h~~CIvTQREvGvD  185 (375)
T COG5008         110 FEELKLPEVLKDLALAKRGLVIIVGATGSGKSTTMAAMIGY----RNKNSTGHIITIEDPIEFIHKHKRCIVTQREVGVD  185 (375)
T ss_pred             HHhcCCcHHHHHhhcccCceEEEECCCCCCchhhHHHHhcc----cccCCCCceEEecChHHHHhcccceeEEeeeeccc
Confidence            3444433333  35678998888654  6777777555432    222     1113456899999999999999843  


Q ss_pred             ---ccccCCCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEE
Q 022015          216 ---WFTNVTVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCL  262 (304)
Q Consensus       216 ---~~v~i~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~L  262 (304)
                         |.+.+.-+-=|+-|.+.|..+|-|    ||++-=.+=|-.||-.||-
T Consensus       186 Tesw~~AlkNtlRQapDvI~IGEvRsr----etMeyAi~fAeTGHLcmaT  231 (375)
T COG5008         186 TESWEVALKNTLRQAPDVILIGEVRSR----ETMEYAIQFAETGHLCMAT  231 (375)
T ss_pred             hHHHHHHHHHHHhcCCCeEEEeecccH----hHHHHHHHHHhcCceEEEE
Confidence               334444566789999999999999    9999888889999988875


No 21 
>PF09713 A_thal_3526:  Plant protein 1589 of unknown function (A_thal_3526);  InterPro: IPR006476 This plant-specific family of proteins are defined by an uncharacterised region 57 residues in length. It is found toward the N terminus of most proteins that contain it. Examples include at least several proteins from Arabidopsis thaliana (Mouse-ear cress) and Oryza sativa (Rice). The function of the proteins are unknown.
Probab=32.75  E-value=11  Score=28.45  Aligned_cols=38  Identities=26%  Similarity=0.492  Sum_probs=30.6

Q ss_pred             EEechhhHhHHHHHHhhccccCCCccc--ccccHHHHHHh
Q 022015          167 FLMQAGMLGTLEALWDVFPLFTNTGWG--ENSNIGFLKKH  204 (304)
Q Consensus       167 Flm~~G~~~TL~sL~dtlpLFsnt~WG--e~~Nl~FLk~~  204 (304)
                      |+-++-+..+|..-..+-|.||.+.|.  |..|.+|-+..
T Consensus        12 yMsk~E~v~~L~~~a~I~P~~T~~VW~~Le~eN~eFF~aY   51 (54)
T PF09713_consen   12 YMSKEECVRALQKQANIEPVFTSTVWQKLEKENPEFFKAY   51 (54)
T ss_pred             cCCHHHHHHHHHHHcCCChHHHHHHHHHHHHHCHHHHHHh
Confidence            444566777777777788999999999  69999999875


No 22 
>PF09652 Cas_VVA1548:  Putative CRISPR-associated protein (Cas_VVA1548);  InterPro: IPR013443 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.   This entry represents a conserved region of about 95 amino acids found exclusively in species with CRISPR repeats. In all bacterial species that contain this entry, the genes encoding the proteins are in the midst of a cluster of cas genes.
Probab=32.51  E-value=31  Score=28.85  Aligned_cols=32  Identities=19%  Similarity=0.431  Sum_probs=23.9

Q ss_pred             ccHHHHHHhcCCceeecCCCccccCCCCcCCCCCEEE
Q 022015          196 SNIGFLKKHMGASFEQRPEPWFTNVTVEEIHSGDFLA  232 (304)
Q Consensus       196 ~Nl~FLk~~mG~~fe~R~~p~~v~i~~~DIhSGDFLa  232 (304)
                      ..++++++. |+...++    +.-+|+++|++||.+.
T Consensus         8 GAieW~~~q-g~~iD~~----v~Hld~~~i~~GD~Vi   39 (93)
T PF09652_consen    8 GAIEWAKQQ-GIQIDHF----VDHLDPADIQPGDVVI   39 (93)
T ss_pred             cHHHHHHHh-CCCccee----eccCCHHHccCCCEEE
Confidence            457888887 6655444    4578999999999864


No 23 
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in ribosomal proteins, NusG, Spt5p, KIN17 and T54.
Probab=31.47  E-value=91  Score=18.69  Aligned_cols=23  Identities=26%  Similarity=0.507  Sum_probs=16.3

Q ss_pred             CCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEe
Q 022015          225 IHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLR  263 (304)
Q Consensus       225 IhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lr  263 (304)
                      ++.||.+.|.                .|.++|+.+..++
T Consensus         2 ~~~G~~V~I~----------------~G~~~g~~g~i~~   24 (28)
T smart00739        2 FEVGDTVRVI----------------AGPFKGKVGKVLE   24 (28)
T ss_pred             CCCCCEEEEe----------------ECCCCCcEEEEEE
Confidence            4677777776                5677777777764


No 24 
>PF00877 NLPC_P60:  NlpC/P60 family;  InterPro: IPR000064 The Escherichia coli NLPC/Listeria P60 domain occurs at the C terminus of a number of different bacterial and viral proteins. The viral proteins are either described as tail assembly proteins or Gp19. In bacteria, the proteins are variously described as being putative tail component of prophage, invasin, invasion associated protein, putative lipoprotein, cell wall hydrolase, or putative endopeptidase.  The E. coli NLPC/Listeria P60 domain is contained within the boundaries of the cysteine peptidase domain that defines the MEROPS peptidase family C40 (clan C-). A type example being dipeptidyl-peptidase VI from Bacillus sphaericus and gamma-glutamyl-diamino acid-endopeptidase precursor from Lactococcus lactis 3.4.19.11 from EC. This group also contains proteins classified as non-peptidase homologues in that they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of peptidases in the C40 family. ; PDB: 3PVQ_B 3GT2_A 3NPF_B 2K1G_A 3I86_A 3S0Q_A 2XIV_A 3PBC_A 3NE0_A 3M1U_B ....
Probab=30.32  E-value=35  Score=26.61  Aligned_cols=37  Identities=24%  Similarity=0.489  Sum_probs=26.6

Q ss_pred             cCCCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEecc
Q 022015          219 NVTVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESG  275 (304)
Q Consensus       219 ~i~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~  275 (304)
                      .++.++.++||.|....                +..+.|.+|.+  .+|+  +++++
T Consensus        46 ~~~~~~~~pGDlif~~~----------------~~~~~Hvgiy~--g~~~--~iha~   82 (105)
T PF00877_consen   46 RVPISELQPGDLIFFKG----------------GGGISHVGIYL--GDGK--FIHAS   82 (105)
T ss_dssp             HEEGGG-TTTEEEEEEG----------------TGGEEEEEEEE--ETTE--EEEEE
T ss_pred             ccchhcCCcccEEEEeC----------------CccCCEeEEEE--eCCe--EEEeC
Confidence            36789999999998762                67789999999  2443  44554


No 25 
>PF14133 DUF4300:  Domain of unknown function (DUF4300)
Probab=28.42  E-value=47  Score=31.73  Aligned_cols=25  Identities=24%  Similarity=0.349  Sum_probs=18.9

Q ss_pred             CcceeEEEEecCCCcEEEEeccCccc
Q 022015          254 YAGHTAVCLRDSEGKLWVGESGHEND  279 (304)
Q Consensus       254 ~aGHTav~Lrd~dGeLwV~ES~~en~  279 (304)
                      +.||+.|++.+.|| ++.+|=..=.+
T Consensus       185 FvGH~GVLv~~~dg-~LFiEKlaf~e  209 (250)
T PF14133_consen  185 FVGHTGVLVPTKDG-YLFIEKLAFEE  209 (250)
T ss_pred             EeeeEEEEEEcCCc-EEEEEeeCCCC
Confidence            57999999987666 88888554433


No 26 
>PF13854 Kelch_5:  Kelch motif
Probab=28.16  E-value=64  Score=21.73  Aligned_cols=17  Identities=24%  Similarity=0.456  Sum_probs=14.3

Q ss_pred             cCcceeEEEEecCCCcEEEE
Q 022015          253 AYAGHTAVCLRDSEGKLWVG  272 (304)
Q Consensus       253 A~aGHTav~Lrd~dGeLwV~  272 (304)
                      ++.||+++..   +++|||.
T Consensus         4 ~R~~hs~~~~---~~~iyi~   20 (42)
T PF13854_consen    4 PRYGHSAVVV---GNNIYIF   20 (42)
T ss_pred             CccceEEEEE---CCEEEEE
Confidence            6899999987   4889985


No 27 
>PF01904 DUF72:  Protein of unknown function DUF72;  InterPro: IPR002763 The function of this family is unknown. Aquifex aeolicus has two copies of this protein. A probable aspartyl-tRNA synthetase from Escherichia coli [] belongs to this group.; PDB: 1VPY_A 1ZTV_A 1VPQ_A.
Probab=27.46  E-value=2.4e+02  Score=25.73  Aligned_cols=82  Identities=22%  Similarity=0.398  Sum_probs=40.6

Q ss_pred             hhcCeEEEEechh------hHhHHHHHHhhcc-cc------CCCcccccccHHHHHHhcCCceeecCCCccccCCCCcCC
Q 022015          160 KNKGVSIFLMQAG------MLGTLEALWDVFP-LF------TNTGWGENSNIGFLKKHMGASFEQRPEPWFTNVTVEEIH  226 (304)
Q Consensus       160 k~~Gv~IFlm~~G------~~~TL~sL~dtlp-LF------snt~WGe~~Nl~FLk~~mG~~fe~R~~p~~v~i~~~DIh  226 (304)
                      .+-|.-+|.+|-.      -...|.++.+-+| -+      .|..|-...=.++|+++ |+.+.--..|..-.+.+...+
T Consensus        84 ~klg~iL~Q~Ppsf~~~~~~~~~l~~~l~~~~~~~~~avE~R~~sW~~~~~~~~l~~~-~~~~v~~d~~~~~~~p~~~~~  162 (230)
T PF01904_consen   84 EKLGPILFQFPPSFRFTPENLERLDAFLDRLPRGFRYAVEFRHPSWFTEEVFELLREH-GVALVIADSPRLPSLPPPEPQ  162 (230)
T ss_dssp             T-EEEEEEE--TT--S-HHHHHHHHHHHHHTT-TS-EEEE--BGGGGCHHHHHHHHHT-T-EEEEEE---BTTC------
T ss_pred             hcceEEEEEcCCCcCCCHHHHHHHHHHHhhcccccceEEecCCcchhhHHHHHHHHHc-CCEEEEeCCcccCCCCCcccc
Confidence            3568899999864      4455666666665 22      37778876667888875 555554444432334433333


Q ss_pred             CCCEEEEEeecccCCc
Q 022015          227 SGDFLAVSKIRGRWGG  242 (304)
Q Consensus       227 SGDFLaVsrirgrwdG  242 (304)
                      ...=+++.|+.||=++
T Consensus       163 ~~~~~~y~RlhG~~~~  178 (230)
T PF01904_consen  163 TTPDFAYVRLHGRNGE  178 (230)
T ss_dssp             SSTTEEEEEE--S-TT
T ss_pred             cCCCCeEEeeccCccc
Confidence            3323467799999443


No 28 
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=27.08  E-value=71  Score=24.53  Aligned_cols=19  Identities=16%  Similarity=0.205  Sum_probs=15.2

Q ss_pred             ceeEEEEecCCCcEEEEec
Q 022015          256 GHTAVCLRDSEGKLWVGES  274 (304)
Q Consensus       256 GHTav~Lrd~dGeLwV~ES  274 (304)
                      |...+.++||||.++-+-|
T Consensus       100 g~r~~~~~DPdGn~iei~~  118 (120)
T cd09011         100 GQRVVRFYDPDKHIIEVGE  118 (120)
T ss_pred             ccEEEEEECCCCCEEEEec
Confidence            4467888999999997765


No 29 
>cd03467 Rieske Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes. The Rieske domain can be divided into two subdomains, with an incomplete six-stranded, antiparallel beta-barrel at one end, and an iron-sulfur cluster binding subdomain at the other. The Rieske iron-sulfur center contains a [2Fe-2S] cluster, which is involved in electron transfer, and is liganded to two histidine and two cysteine residues present in conserved sequences called Rieske motifs. In RO systems, the N-terminal Rieske domain of the alpha subunit acts as an electron shuttle that accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron in the alpha subunit C-terminal domain to be used for catalysis.
Probab=26.89  E-value=2e+02  Score=21.92  Aligned_cols=45  Identities=18%  Similarity=0.316  Sum_probs=31.3

Q ss_pred             CCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEeccCcccccccc
Q 022015          221 TVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESGHENDEVKLT  284 (304)
Q Consensus       221 ~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~~en~~~~~~  284 (304)
                      ..++|.+|+-..+. +                  .|...+.+|+.+|++|+.+----...+.|.
T Consensus         6 ~~~~~~~~~~~~~~-~------------------~~~~~~v~~~~~~~~~a~~~~CpH~g~~l~   50 (98)
T cd03467           6 ALSELPPGGGRVVV-V------------------GGGPVVVVRREGGEVYALSNRCTHQGCPLS   50 (98)
T ss_pred             eccccCCCceEEEE-E------------------CCeEEEEEEeCCCEEEEEcCcCCCCCccCC
Confidence            35678888877664 2                  267788888878899998866555544443


No 30 
>PF04473 DUF553:  Transglutaminase-like domain;  InterPro: IPR007562 This entry represents a transglutaminase-like domain found in a family of uncharacterised archaeal proteins that had previously been called DUF553 and UPF0252.
Probab=24.56  E-value=65  Score=28.48  Aligned_cols=19  Identities=37%  Similarity=0.658  Sum_probs=16.5

Q ss_pred             ceeEEEEecCCCcEEEEecc
Q 022015          256 GHTAVCLRDSEGKLWVGESG  275 (304)
Q Consensus       256 GHTav~Lrd~dGeLwV~ES~  275 (304)
                      ||.|++++ .||++||+.=+
T Consensus       109 ~Haa~aV~-ing~~yvlDq~  127 (153)
T PF04473_consen  109 GHAAVAVK-INGKYYVLDQH  127 (153)
T ss_pred             CeEEEEEE-ECCEEEEEeCC
Confidence            79999996 79999998643


No 31 
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain. All proteins that score above the trusted cutoff score of 45 to this model are large proteins of either Pirellula sp. 1 or Verrucomicrobium spinosum. These proteins all contain, in addition to this domain, several hundred residues of highly variable sequence, and then a well-conserved C-terminal domain (TIGR02603) that features a putative cytochrome c-type heme binding motif CXXCH. The membrane-bound L-sorbosone dehydrogenase from Acetobacter liquefaciens (Gluconacetobacter liquefaciens) is homologous to this domain but lacks additional sequence regions shared by members of this family and belongs to a different clade of the larger family of homologs. It and its closely related homologs are excluded from the this model by scoring between the trusted (45) and noise (18) cutoffs.
Probab=24.29  E-value=60  Score=31.06  Aligned_cols=17  Identities=53%  Similarity=1.075  Sum_probs=13.5

Q ss_pred             eEEEEecCCCcEEEEecc
Q 022015          258 TAVCLRDSEGKLWVGESG  275 (304)
Q Consensus       258 Tav~Lrd~dGeLwV~ES~  275 (304)
                      .+|++ |++|.|||+|+.
T Consensus        17 ~~ia~-d~~G~l~V~e~~   33 (367)
T TIGR02604        17 IAVCF-DERGRLWVAEGI   33 (367)
T ss_pred             ceeeE-CCCCCEEEEeCC
Confidence            34555 999999999974


No 32 
>TIGR01589 A_thal_3526 uncharacterized plant-specific domain TIGR01589. This model represents an uncharacterized plant-specific domain 57 residues in length. It is found toward the N-terminus of most proteins that contain it. Examples include at least 10 proteins from Arabidopsis thaliana and at least one from Oryza sativa.
Probab=23.87  E-value=19  Score=27.58  Aligned_cols=38  Identities=21%  Similarity=0.308  Sum_probs=30.4

Q ss_pred             EEechhhHhHHHHHHhhccccCCCccc--ccccHHHHHHh
Q 022015          167 FLMQAGMLGTLEALWDVFPLFTNTGWG--ENSNIGFLKKH  204 (304)
Q Consensus       167 Flm~~G~~~TL~sL~dtlpLFsnt~WG--e~~Nl~FLk~~  204 (304)
                      |+-.+-..++|..-...=|.||.+.|.  |..|.+|-+..
T Consensus        15 yMsk~E~v~~L~~~a~I~P~~T~~VW~~LekeN~eFF~aY   54 (57)
T TIGR01589        15 YMSKEETVSFLFENAGISPKFTRFVWYLLEKENADFFRCY   54 (57)
T ss_pred             HCCHHHHHHHHHHHcCCCchhHHHHHHHHHHHHHHHHHHH
Confidence            344456677777777888999999999  69999998864


No 33 
>cd03480 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase (RO) family, Pheophorbide a oxygenase (PaO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of a small subfamily of enzymes found in plants as well as oxygenic cyanobacterial photosynthesizers including LLS1 (lethal leaf spot 1, also known as PaO) and ACD1 (accelerated cell death 1). ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. PaO expression increases upon physical wounding of plant leaves and is thought to catalyze a key step in chlorophyll degradation. The
Probab=23.68  E-value=1e+02  Score=26.04  Aligned_cols=41  Identities=15%  Similarity=0.272  Sum_probs=29.9

Q ss_pred             ccccCCCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecC-CCcEEEEecc
Q 022015          216 WFTNVTVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDS-EGKLWVGESG  275 (304)
Q Consensus       216 ~~v~i~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~-dGeLwV~ES~  275 (304)
                      |..-...+||..|+...+. +                  -|...+..|+. ||++|+.+..
T Consensus        18 W~~v~~~~el~~g~~~~~~-~------------------~g~~i~v~r~~~dG~~~A~~n~   59 (138)
T cd03480          18 WYPVAYVEDLDPSRPTPFT-L------------------LGRDLVIWWDRNSQQWRAFDDQ   59 (138)
T ss_pred             eEEEEEHHHCCCCCcEEEE-E------------------CCeeEEEEEECCCCEEEEEcCC
Confidence            6334456889999987664 3                  25677888876 9999998864


No 34 
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase. Members of this protein family are the enzyme methylmalonyl-CoA epimerase (EC 5.1.99.1), also called methylmalonyl-CoA racemase. This enzyme converts (2R)-methylmalonyl-CoA to (2S)-methylmalonyl-CoA, which is then a substrate for methylmalonyl-CoA mutase (TIGR00642). It is known in bacteria, archaea, and as a mitochondrial protein in animals. It is closely related to lactoylglutathione lyase (TIGR00068), which is also called glyoxylase I, and is also a homodimer.
Probab=23.66  E-value=60  Score=24.61  Aligned_cols=15  Identities=27%  Similarity=0.483  Sum_probs=12.5

Q ss_pred             ceeEEEE--ecCCCcEE
Q 022015          256 GHTAVCL--RDSEGKLW  270 (304)
Q Consensus       256 GHTav~L--rd~dGeLw  270 (304)
                      |+.++++  |||||.++
T Consensus       108 g~~~~~~~~~dp~G~~~  124 (128)
T TIGR03081       108 GKPVAFLHPKSTGGVLI  124 (128)
T ss_pred             CCEEEEecccccCcEEE
Confidence            6778888  89999886


No 35 
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The oxygenase component may contain alpha and beta subunits, with the beta subunit having a purely structural function. Some oxygenase components contain only an alpha subunit. The oxygenase alpha subunit has two domains, an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from the reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Reduced pyridine nucleotide is used as the i
Probab=23.26  E-value=1.2e+02  Score=23.96  Aligned_cols=35  Identities=23%  Similarity=0.490  Sum_probs=26.4

Q ss_pred             CCcCC-CCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEecc
Q 022015          222 VEEIH-SGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESG  275 (304)
Q Consensus       222 ~~DIh-SGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~  275 (304)
                      .+||. +|+.+.+. +                  .|+..+..|+.||++++.+.-
T Consensus         7 ~~el~~~g~~~~~~-~------------------~~~~i~v~r~~~g~~~a~~n~   42 (118)
T cd03469           7 SSELPEPGDYVTLE-L------------------GGEPLVLVRDRDGEVRAFHNV   42 (118)
T ss_pred             HHHCCCCCCEEEEE-E------------------CCccEEEEECCCCCEEEEEEe
Confidence            46787 89877654 3                  167788888889999998753


No 36 
>cd03532 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. Vanillate-O-demethylase is a heterodimeric enzyme consisting of a terminal oxygenase (VanA) and reductase (VanB) components. This enzyme reductively catalyzes the conversion of vanillate into protocatechuate and formaldehyde. Protocatechuate and vanillate are important intermediate metabolites in the degrad
Probab=23.19  E-value=98  Score=25.02  Aligned_cols=40  Identities=23%  Similarity=0.383  Sum_probs=28.2

Q ss_pred             ccccCCCCcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEecc
Q 022015          216 WFTNVTVEEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESG  275 (304)
Q Consensus       216 ~~v~i~~~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~  275 (304)
                      |..-...+||. |+...+.-                   .|...+..|+.||++++.+.-
T Consensus         6 W~~v~~~~el~-~~~~~~~~-------------------~g~~i~l~r~~~g~~~a~~n~   45 (116)
T cd03532           6 WYVAAWADELG-DKPLARTL-------------------LGEPVVLYRTQDGRVAALEDR   45 (116)
T ss_pred             EEEEEEHHHcC-CCcEEEEE-------------------CCceEEEEECCCCCEEEeCCc
Confidence            53444567776 77766542                   366788899889999998863


No 37 
>cd03422 YedF YedF is a bacterial SirA-like protein of unknown function.  SirA  (also known as UvrY,  and YhhP) belongs to a family of a two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA. A variety of microorganisms have similar proteins, all of which contain a common CPxP sequence motif in the N-terminal region. YhhP is suggested to be important for normal cell division and growth in rich nutrient medium.  Moreover, despite a low primary sequence similarity,  the YccP structure closely resembles the non-homologous C-terminal RNA-binding domain of E. coli translation initiation factor IF3. The signature CPxP motif serves to stabilize the N-terminal helix as part of the N-capping box and might be important in mRNA-binding.
Probab=22.28  E-value=2.2e+02  Score=21.26  Aligned_cols=45  Identities=11%  Similarity=0.128  Sum_probs=33.0

Q ss_pred             CcCCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEE
Q 022015          223 EEIHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVG  272 (304)
Q Consensus       223 ~DIhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~  272 (304)
                      .++.+||.|.|. .... ...+-+.+|..  ..||......+ +|..|.+
T Consensus        21 ~~l~~G~~l~V~-~d~~-~s~~ni~~~~~--~~g~~v~~~~~-~~~~~~~   65 (69)
T cd03422          21 PSLKPGEILEVI-SDCP-QSINNIPIDAR--NHGYKVLAIEQ-SGPTIRY   65 (69)
T ss_pred             HcCCCCCEEEEE-ecCc-hHHHHHHHHHH--HcCCEEEEEEe-cCCEEEE
Confidence            578999988773 3333 56788999996  78999998865 5555654


No 38 
>PF13629 T2SS-T3SS_pil_N:  Pilus formation protein N terminal region
Probab=21.62  E-value=97  Score=23.38  Aligned_cols=42  Identities=19%  Similarity=0.392  Sum_probs=29.5

Q ss_pred             CCCCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCc-EEEEe
Q 022015          225 IHSGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGK-LWVGE  273 (304)
Q Consensus       225 IhSGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGe-LwV~E  273 (304)
                      |-.++..-+.=+..|       +-.++|-.+|-|.+.+||.+|+ ++..+
T Consensus        26 v~dp~Iadv~~~~~~-------~v~i~gk~~G~T~l~vw~~~~~~~~~~~   68 (72)
T PF13629_consen   26 VGDPEIADVTVLSPN-------EVYITGKKPGTTTLIVWDKDGRVIQTYD   68 (72)
T ss_pred             ECCCCEEEEEEeCCC-------EEEEEEeCceeEEEEEECCCCCEEEEEE
Confidence            334445555545333       6678899999999999999998 66543


No 39 
>TIGR03047 PS_II_psb28 photosystem II reaction center protein Psb28. Members of this protein family are the Psb28 protein of photosystem II. Two different protein families, apparently without homology between them, have been designated PsbW. Cyanobacterial proteins previously designated PsbW are members of the family described here. However, while members of the plant PsbW family are not found (so far) in Cyanobacteria, members of the present family do occur in plants. We therefore support the alternative designation that has emerged for this protein family, Psp28, rather than PsbW.
Probab=20.84  E-value=1.5e+02  Score=25.56  Aligned_cols=54  Identities=24%  Similarity=0.205  Sum_probs=39.4

Q ss_pred             EEEEeecccCCchhhHHH--hhcCcCcceeEEEEecCCCcEEEEeccCccccccccccccccch
Q 022015          231 LAVSKIRGRWGGFETLEK--WVTGAYAGHTAVCLRDSEGKLWVGESGHENDEVKLTDLLTCCDS  292 (304)
Q Consensus       231 LaVsrirgrwdGfdtlik--W~TGA~aGHTav~Lrd~dGeLwV~ES~~en~~~~~~~~~~~~~~  292 (304)
                      -|+.+.    +-...+.+  -.+|...|   |.|.|++|+|-+-|+..+=-.|+... +.|---
T Consensus        27 ~a~f~F----~~p~al~~~~~~~~~itG---m~LiDeEGei~tr~v~~KFvnGkp~~-iEa~y~   82 (109)
T TIGR03047        27 TALFRF----ENPKALDKFNSDTGEITG---MYLIDEEGEIVTREVKAKFVNGKPKA-LEAVYI   82 (109)
T ss_pred             EEEEEE----CCchhhhhccccccceee---EEEEccCccEEEEecceEEECCCccE-EEEEEE
Confidence            444544    55666666  56788888   99999999999999988877777665 445433


No 40 
>PF14288 FKS1_dom1:  1,3-beta-glucan synthase subunit FKS1, domain-1
Probab=20.50  E-value=31  Score=29.58  Aligned_cols=75  Identities=25%  Similarity=0.359  Sum_probs=40.5

Q ss_pred             HHHHhhccccCCCcccccccHHHH-------HHhcCCceeecCCCcc-----ccCCCCcCCCCCEE--EEEeecccCCch
Q 022015          178 EALWDVFPLFTNTGWGENSNIGFL-------KKHMGASFEQRPEPWF-----TNVTVEEIHSGDFL--AVSKIRGRWGGF  243 (304)
Q Consensus       178 ~sL~dtlpLFsnt~WGe~~Nl~FL-------k~~mG~~fe~R~~p~~-----v~i~~~DIhSGDFL--aVsrirgrwdGf  243 (304)
                      ++|+-.+       |||++|+.|.       =|+|-..+....+...     .........+|+||  +|+=|    =.+
T Consensus         7 iaLYLLi-------WGEAaNlRfmPECLCfIFh~ma~~~~~~~~~~~~~~~~~~~~~~~~~~~~FL~~VItPi----Y~~   75 (117)
T PF14288_consen    7 IALYLLI-------WGEAANLRFMPECLCFIFHHMAMDYYRSLESQGSENTGEPVPPPSVPEGSFLDHVITPI----YEF   75 (117)
T ss_pred             HHHHHHH-------HHHHhcccccHHHHHHHHHHHHHHHHhhhhccccccccCCCCCCCCCchHHHHhhhHHH----HHH
Confidence            3555555       9999999764       4556666554433211     11245677889998  44443    111


Q ss_pred             --hhHHHhhcCcCcceeEEEEec
Q 022015          244 --ETLEKWVTGAYAGHTAVCLRD  264 (304)
Q Consensus       244 --dtlikW~TGA~aGHTav~Lrd  264 (304)
                        ++.-+| .+.-+-|+.+.--|
T Consensus        76 i~~q~~~~-~~~~~dH~~~~nYD   97 (117)
T PF14288_consen   76 IRDQQYSS-VRGEADHSDWRNYD   97 (117)
T ss_pred             HHHHhHhh-cCCCCCccccCCCC
Confidence              111222 34455677765544


No 41 
>cd03538 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygenase (RO) family, Anthranilate 1,2-dioxygenase (AntDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. AntDO converts anthranilate to catechol, a naturally occurring compound formed through tryptophan degradation and an important intermediate in the metabolism of many N-heterocyclic compounds such as indole, o-nitrobenzoate, carbazole, and quinaldine.
Probab=20.39  E-value=1.4e+02  Score=25.48  Aligned_cols=41  Identities=20%  Similarity=0.432  Sum_probs=30.0

Q ss_pred             ccccCCCCcCC-CCCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEecc
Q 022015          216 WFTNVTVEEIH-SGDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESG  275 (304)
Q Consensus       216 ~~v~i~~~DIh-SGDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~  275 (304)
                      |..-...+||. +||++.+. +                  -|...+..|+.||++++.+.-
T Consensus        23 W~~v~~~~elp~~G~~~~~~-i------------------~g~~i~v~r~~~g~v~A~~n~   64 (146)
T cd03538          23 WIYVGHESQVPNPGDYITTR-I------------------GDQPVVMVRHTDGSVHVLYNR   64 (146)
T ss_pred             CEEEEEHHHCCCCCCEEEEE-E------------------CCeeEEEEECCCCCEEEEecc
Confidence            63334457786 79998875 4                  255788899889999998853


No 42 
>smart00788 Adenylsucc_synt Adenylosuccinate synthetase. Adenylosuccinate synthetase plays an important role in purine biosynthesis, by catalyzing the GTP-dependent conversion of IMP and aspartic acid to AMP. Adenylosuccinate synthetase has been characterized from various sources ranging from Escherichia coli (gene purA) to vertebrate tissues. In vertebrates, two isozymes are present - one involved in purine biosynthesis and the other in the purine nucleotide cycle. The crystal structure of adenylosuccinate synthetase from E. coli reveals that the dominant structural element of each monomer of the homodimer is a central beta-sheet of 10 strands. The first nine strands of the sheet are mutually parallel with right-handed crossover connections between the strands. The 10th strand is antiparallel with respect to the first nine strands. In addition, the enzyme has two antiparallel beta-sheets, comprised of two strands and three strands each, 11 alpha-helices and two short 3/10-helices. Furt
Probab=20.30  E-value=44  Score=34.13  Aligned_cols=34  Identities=32%  Similarity=0.377  Sum_probs=23.3

Q ss_pred             hhhHHHhhcCcCcceeEEEEecCCCc--EEEEeccCccc
Q 022015          243 FETLEKWVTGAYAGHTAVCLRDSEGK--LWVGESGHEND  279 (304)
Q Consensus       243 fdtlikW~TGA~aGHTav~Lrd~dGe--LwV~ES~~en~  279 (304)
                      .|-...+-.|+.||||++.  + .++  |..+=||--+.
T Consensus        25 ~d~VvR~~GG~NAGHTvv~--~-g~k~~lhllPSGil~~   60 (421)
T smart00788       25 ADVVVRFQGGNNAGHTVVV--G-GKKYKLHLLPSGILNP   60 (421)
T ss_pred             CCEEEEccccCCCCcEEEE--C-CEEEEEEecCccccCC
Confidence            3555666789999999984  2 333  56667777664


No 43 
>PF09916 DUF2145:  Uncharacterized protein conserved in bacteria (DUF2145);  InterPro: IPR014547 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.25  E-value=1.4e+02  Score=27.99  Aligned_cols=46  Identities=22%  Similarity=0.533  Sum_probs=32.7

Q ss_pred             CCEEEEEeecccCCchhhHHHhhcCcCcceeEEEEecCCCcEEEEeccCccccccccccccccchh
Q 022015          228 GDFLAVSKIRGRWGGFETLEKWVTGAYAGHTAVCLRDSEGKLWVGESGHENDEVKLTDLLTCCDSM  293 (304)
Q Consensus       228 GDFLaVsrirgrwdGfdtlikW~TGA~aGHTav~Lrd~dGeLwV~ES~~en~~~~~~~~~~~~~~~  293 (304)
                      .....|.|. ||     .+.+|  |=+-.|.++++|++|| -|.           +..|+.-|++.
T Consensus         8 a~vvilaR~-Gq-----dls~~--GirySH~a~a~~~~dG-~w~-----------V~~lyn~c~~~   53 (201)
T PF09916_consen    8 ARVVILARA-GQ-----DLSRY--GIRYSHAAFAVRTADG-GWR-----------VYHLYNDCGTD   53 (201)
T ss_pred             CcEEEEEec-CC-----ChHHc--CCeeeeEEEEEEcCCC-Cee-----------eeehhhhcCch
Confidence            345666766 55     56777  9999999999999889 443           34566666653


No 44 
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=20.21  E-value=1e+02  Score=23.23  Aligned_cols=18  Identities=17%  Similarity=0.246  Sum_probs=13.1

Q ss_pred             CcceeEEEEecCCCcEEE
Q 022015          254 YAGHTAVCLRDSEGKLWV  271 (304)
Q Consensus       254 ~aGHTav~Lrd~dGeLwV  271 (304)
                      ..|+..+.++||||.++-
T Consensus       104 ~~~~~~~~~~DPdG~~iE  121 (125)
T cd08357         104 PGEQETFFLKDPSGNALE  121 (125)
T ss_pred             cCceeEEEEECCCCCEEE
Confidence            344566778899998874


Done!