BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 022063
         (303 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3UE3|A Chain A, Crystal Structure Of Acinetobacter Baumanni Pbp3
          Length = 554

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 22/39 (56%)

Query: 254 YSFAVWATFVGFAYGYATIVSKSIVVPMASHALNNLVGG 292
           Y + + AT +  A GYA + +  + +P++ H L+ +  G
Sbjct: 393 YGYGLNATILQLAQGYAMLANHGVEMPLSLHKLDQVPEG 431


>pdb|1M56|C Chain C, Structure Of Cytochrome C Oxidase From Rhodobactor
           Sphaeroides (Wild Type)
 pdb|1M56|I Chain I, Structure Of Cytochrome C Oxidase From Rhodobactor
           Sphaeroides (Wild Type)
 pdb|1M57|C Chain C, Structure Of Cytochrome C Oxidase From Rhodobacter
           Sphaeroides (Eq(I-286) Mutant))
 pdb|1M57|I Chain I, Structure Of Cytochrome C Oxidase From Rhodobacter
           Sphaeroides (Eq(I-286) Mutant))
          Length = 266

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 6/55 (10%)

Query: 145 PFLDG--STEVTFDFELWHLELITGLVVLVSSCRYLLLKTWPDFAKSSEAANQQV 197
           P +DG    E    F+ WHL LI  L++L S C      TW   A   E   + V
Sbjct: 114 PIIDGIFPPEGIITFDPWHLPLINTLILLCSGCA----ATWAHHALVHENNRRDV 164


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.134    0.398 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,360,094
Number of Sequences: 62578
Number of extensions: 321898
Number of successful extensions: 1009
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 1003
Number of HSP's gapped (non-prelim): 11
length of query: 303
length of database: 14,973,337
effective HSP length: 98
effective length of query: 205
effective length of database: 8,840,693
effective search space: 1812342065
effective search space used: 1812342065
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)