BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 022101
         (302 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1YIQ|A Chain A, Molecular Cloning And Structural Analysis Of
           Quinohemoprotein Alcohol Dehydrogenase Adhiig From
           Pseudomonas Putida Hk5. Compariison To The Other
           Quinohemoprotein Alcohol Dehydrogenase Adhiib Found In
           The Same Microorganism
          Length = 689

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 7/58 (12%)

Query: 226 NGRNWIDREPYAYWKGNPFVAETRRDLLTCNLSDKHDWNARLYVQVISFIYI-THLCS 282
            GR  +D E  AYWK        +R+L+T      HDW    Y      +YI  H+ S
Sbjct: 360 TGRPILDEENAAYWKNG------KRNLVTPAFWGAHDWQPMSYNPDTGLVYIPAHIMS 411


>pdb|3Q7J|A Chain A, Engineered Thermoplasma Acidophilum F3 Factor Mimics Human
           Aminopeptidase N (Apn) As A Target For Anticancer Drug
           Development
 pdb|3Q7J|B Chain B, Engineered Thermoplasma Acidophilum F3 Factor Mimics Human
           Aminopeptidase N (Apn) As A Target For Anticancer Drug
           Development
          Length = 780

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/13 (76%), Positives = 12/13 (92%)

Query: 193 TMDIVFPDWSFWG 205
           TMD +FP+WSFWG
Sbjct: 298 TMDTLFPEWSFWG 310


>pdb|1Z1W|A Chain A, Crystal Structures Of The Tricorn Interacting Facor F3
           From Thermoplasma Acidophilum, A Zinc Aminopeptidase In
           Three Different Conformations
 pdb|1Z5H|A Chain A, Crystal Structures Of The Tricorn Interacting Factor F3
           From Thermoplasma Acidophilum
 pdb|1Z5H|B Chain B, Crystal Structures Of The Tricorn Interacting Factor F3
           From Thermoplasma Acidophilum
          Length = 780

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/13 (76%), Positives = 12/13 (92%)

Query: 193 TMDIVFPDWSFWG 205
           TMD +FP+WSFWG
Sbjct: 298 TMDTLFPEWSFWG 310


>pdb|3QKW|A Chain A, Structure Of Streptococcus Parasangunini Gtf3
           Glycosyltransferase
 pdb|3QKW|B Chain B, Structure Of Streptococcus Parasangunini Gtf3
           Glycosyltransferase
 pdb|3QKW|C Chain C, Structure Of Streptococcus Parasangunini Gtf3
           Glycosyltransferase
 pdb|3QKW|D Chain D, Structure Of Streptococcus Parasangunini Gtf3
           Glycosyltransferase
          Length = 332

 Score = 27.3 bits (59), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 208 EINIKPWESLLRELKEGNNGRNWIDREPYAY 238
           +IN +P E LL E+ +G  G  W+D +   Y
Sbjct: 210 KINYRPDEQLLMEMSQGGFGLVWMDDKDKEY 240


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.139    0.460 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,882,865
Number of Sequences: 62578
Number of extensions: 432123
Number of successful extensions: 852
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 847
Number of HSP's gapped (non-prelim): 6
length of query: 302
length of database: 14,973,337
effective HSP length: 98
effective length of query: 204
effective length of database: 8,840,693
effective search space: 1803501372
effective search space used: 1803501372
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 51 (24.3 bits)