Citrus Sinensis ID: 022143


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MKMGSLNAELNENDDHSGSATESDEPTNTKTETDEDKEKECPCPPTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKNDSLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEcEEEEEEEEEccEEEEEEEEccccccHHHHHcccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcc
*************************************************CPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFT**********************************LNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMGSLNAELNENDDHSGSATESDEPTNTKTETDEDKEKECPCPPTPASCPYQVNEKVLAFFQSHVYEAKVIQVQYRLKEWTFRVHYLGWNKSWDEWVGVHRLMKDTEANRHRQPVFTKKRDEDKNLKSGHALQMKPRSSNVGRGRKRKNDSLNKETNGLQMENFVNIQIPPPLKKQLVDDCEFITHLGKLVKLPRTPNVDDILEKYCDYRSKKDGLVADSTGEIVKGLRCYFDKALPIMLLYKSEREQYEDSMAADVSPSSVYGAEHLLRLFVKLPELLVHAKIEEETLTLLQHKLVDLLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chromatin modification-related protein EAF3 Involved in deacetylation of histones, chromatin assembly and chromosome segregation. May act as a transcriptional oscillator, directing histone deacetylases to specific chromosomal domains. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair.probableP0CO86

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y0N, chain A
Confidence level:very confident
Coverage over the Query: 165-302
View the alignment between query and template
View the model in PyMOL
Template: 2F5K, chain A
Confidence level:very confident
Coverage over the Query: 47-122
View the alignment between query and template
View the model in PyMOL