Citrus Sinensis ID: 022151

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MEVVKKTDSLKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRRGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKPPRRSLDGYKHVVDVEYCPPVSSDGPHFTSEAIKAKEAAQNEPNAQNTSEYHVIMEEEMIRGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVADSLRQQESSSFIAASL
cccccccccccEEEEEEEccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHcccccccHHHHHHHHcccEEEEEEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccEEEEEEccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHccccccccc
ccEEEccccEEEEEEEEccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEccEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHccccccHHHHHHHHHHHcHEEEEEEccccEEEEEEccccccccccccccccccccccEEEEccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHccccccEEEEEEEcccccccHEcccEEEEEEcccccccHHHHHHHHHHHHHHHccccEHccc
mevvkktdslKRISFLAHSLGGLFARYAVAVLYSstaeesgepvdladsmrensLTMCSsrrgtiaglepvnfitlatphlgvrgkkqlpflfgVSFLEklalplapilvgqtgsqlflmdgrpdkpplllrmasdcedgKFLSALGAFRCRIVYANVSYDHmvgwrtssirretelvkpprrsldgykhvvdveycppvssdgphftSEAIKAKEaaqnepnaqntseYHVIMEEEMIRGLQRLGWKKVDVSFHSafwpffahnnihvknewlhnagtgvIAHVADSLRQQESSSFIAASL
mevvkktdslkrISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRRGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMvgwrtssirretelvkpprrsldgykhVVDVEYCPPVSSDGPHFTSEAIKAKeaaqnepnaqnTSEYHVIMEEEMIRGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVADSLRQQESSSFIAASL
MEVVKKTDSLKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRRGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKPPRRSLDGYKHVVDVEYCPPVSSDGPHFTSEAIKAKEAAQNEPNAQNTSEYHVIMEEEMIRGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVADSLRQQESSSFIAASL
*********LKRISFLAHSLGGLFARYAVAVLYS***************************RGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELV*****SLDGYKHVVDVEYCP*******************************YHVIMEEEMIRGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVA****************
*******DSLKRISFLAHSLGGLFARYAVAVLYSSTA*********************SSRRGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKPPRRSLDGYKHVVDVEYCP*V*************************NTSEYHVIMEEEMIRGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVADSLRQQESSS**A*S*
********SLKRISFLAHSLGGLFARYAVAVLYSS**********LADSMRENSLTMCSSRRGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKPPRRSLDGYKHVVDVEYCPPVSSDGPHFTSEAIKA**********QNTSEYHVIMEEEMIRGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVADSLR************
MEVVKKTDSLKRISFLAHSLGGLFARYAVAVLYSSTAE**********************RRGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKPPRRSLDGYKHVVDVEYCPPVS**************************SEYHVIMEEEMIRGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVADSLRQQESSSFI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVVKKTDSLKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRRGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKPPRRSLDGYKHVVDVEYCPPVSSDGPHFTSEAIKAKEAAQNEPNAQNTSEYHVIMEEEMIRGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVADSLRQQESSSFIAASL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query302 2.2.26 [Sep-21-2011]
Q08448 450 Putative lipase YOR059C O yes no 0.440 0.295 0.246 2e-07
O14162 785 Putative lipase C4A8.10 O yes no 0.410 0.157 0.290 3e-07
Q04093 687 Putative lipase YDR444W O no no 0.450 0.197 0.291 2e-06
Q12103 647 Putative lipase YDL109C O no no 0.410 0.191 0.290 2e-06
P53118 685 Putative lipase ROG1 OS=S no no 0.380 0.167 0.258 0.0002
>sp|Q08448|YO059_YEAST Putative lipase YOR059C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR059C PE=1 SV=1 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 74/166 (44%), Gaps = 33/166 (19%)

Query: 6   KTDSLKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRRGTI 65
           K   + ++S + +S GGL AR+ +                           M +  +   
Sbjct: 77  KDGKITKLSVMGYSQGGLVARFMIG-------------------------KMLTEFKELF 111

Query: 66  AGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPD 125
             +EP  FIT+ATPHLGV         +  +    L   L   ++G++G ++F+ +   +
Sbjct: 112 EDIEPQLFITMATPHLGVEFYNPTGIAYKSALYSALR-TLGSTILGKSGREMFIANSSNN 170

Query: 126 KPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSI 171
              +L++++     G++L AL  F+ RI +ANV  D  V + T+ I
Sbjct: 171 ---ILVKLSQ----GEYLEALSLFKWRIAFANVKNDRTVAFYTAFI 209

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|O14162|YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.10 PE=3 SV=2 Back     alignment and function description
>sp|Q04093|YD444_YEAST Putative lipase YDR444W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR444W PE=1 SV=1 Back     alignment and function description
>sp|Q12103|YD109_YEAST Putative lipase YDL109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL109C PE=1 SV=1 Back     alignment and function description
>sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
224116912 462 predicted protein [Populus trichocarpa] 1.0 0.653 0.808 1e-141
359483524 460 PREDICTED: uncharacterized protein LOC10 0.996 0.654 0.797 1e-139
255563140 459 catalytic, putative [Ricinus communis] g 1.0 0.657 0.799 1e-138
356512515 443 PREDICTED: uncharacterized protein LOC10 1.0 0.681 0.791 1e-136
357518947 451 Protein FAM135B [Medicago truncatula] gi 1.0 0.669 0.765 1e-136
297740499347 unnamed protein product [Vitis vinifera] 0.923 0.804 0.764 1e-128
388523019370 unknown [Lotus japonicus] 0.986 0.805 0.730 1e-124
30690604 455 hydrolase-like protein [Arabidopsis thal 0.973 0.646 0.760 1e-124
227202730 456 AT1G29120 [Arabidopsis thaliana] 0.973 0.644 0.760 1e-124
297845824 453 hypothetical protein ARALYDRAFT_473118 [ 0.973 0.649 0.757 1e-124
>gi|224116912|ref|XP_002317425.1| predicted protein [Populus trichocarpa] gi|222860490|gb|EEE98037.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  505 bits (1301), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 245/303 (80%), Positives = 271/303 (89%), Gaps = 1/303 (0%)

Query: 1   MEVVKKTDSLKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLA-DSMRENSLTMCS 59
           M VV+K +SLKRISFLAHSLGGLFARYA++VLYS  A  +G+ +D+A D+   NS T CS
Sbjct: 160 MRVVQKRESLKRISFLAHSLGGLFARYAISVLYSEIAVNTGQSIDVAADTSLPNSNTTCS 219

Query: 60  SRRGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFL 119
           SRRG IAGLEP+NFITLATPHLGVRG+KQLPFL G+  LEKLALP+API+VG+TGSQLFL
Sbjct: 220 SRRGMIAGLEPINFITLATPHLGVRGRKQLPFLLGIPILEKLALPIAPIIVGRTGSQLFL 279

Query: 120 MDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVK 179
            DG+P+KP LLLRM SD EDGKFLSALGAFRCRI+YANVSYDHMVGWRTSSIRRE ELV 
Sbjct: 280 TDGKPNKPSLLLRMTSDSEDGKFLSALGAFRCRILYANVSYDHMVGWRTSSIRREMELVT 339

Query: 180 PPRRSLDGYKHVVDVEYCPPVSSDGPHFTSEAIKAKEAAQNEPNAQNTSEYHVIMEEEMI 239
           PP RSLDGYKHVVDVEYCPPVSSDGPHF  EA KAKEAAQNEP+ +NT+EYH +MEEEMI
Sbjct: 340 PPMRSLDGYKHVVDVEYCPPVSSDGPHFPPEAAKAKEAAQNEPSMKNTAEYHELMEEEMI 399

Query: 240 RGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVADSLRQQESSSFIA 299
            GLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEW HNAGTGVI+HVADSL+QQES+ +IA
Sbjct: 400 SGLQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWFHNAGTGVISHVADSLKQQESAMYIA 459

Query: 300 ASL 302
           ASL
Sbjct: 460 ASL 462

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359483524|ref|XP_002266564.2| PREDICTED: uncharacterized protein LOC100266871 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563140|ref|XP_002522574.1| catalytic, putative [Ricinus communis] gi|223538265|gb|EEF39874.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356512515|ref|XP_003524964.1| PREDICTED: uncharacterized protein LOC100790076 [Glycine max] Back     alignment and taxonomy information
>gi|357518947|ref|XP_003629762.1| Protein FAM135B [Medicago truncatula] gi|355523784|gb|AET04238.1| Protein FAM135B [Medicago truncatula] Back     alignment and taxonomy information
>gi|297740499|emb|CBI30681.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388523019|gb|AFK49571.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|30690604|ref|NP_174207.2| hydrolase-like protein [Arabidopsis thaliana] gi|42571689|ref|NP_973935.1| hydrolase-like protein [Arabidopsis thaliana] gi|51971695|dbj|BAD44512.1| unnamed protein product [Arabidopsis thaliana] gi|53749148|gb|AAU90059.1| At1g29120 [Arabidopsis thaliana] gi|332192923|gb|AEE31044.1| hydrolase-like protein [Arabidopsis thaliana] gi|332192924|gb|AEE31045.1| hydrolase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|227202730|dbj|BAH56838.1| AT1G29120 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297845824|ref|XP_002890793.1| hypothetical protein ARALYDRAFT_473118 [Arabidopsis lyrata subsp. lyrata] gi|297336635|gb|EFH67052.1| hypothetical protein ARALYDRAFT_473118 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
TAIR|locus:2117527418 AT4G25770 "AT4G25770" [Arabido 0.860 0.622 0.486 1.9e-58
TAIR|locus:2176172357 AT5G51180 [Arabidopsis thalian 0.625 0.529 0.467 3.3e-57
TAIR|locus:2201901412 AT1G10040 [Arabidopsis thalian 0.884 0.648 0.463 3.8e-53
CGD|CAL0005636434 orf19.4128 [Candida albicans ( 0.417 0.290 0.356 5e-12
UNIPROTKB|Q59KL3434 CaO19.4128 "Potential lipid pa 0.417 0.290 0.356 5e-12
DICTYBASE|DDB_G0275671412 DDB_G0275671 "esterase/lipase/ 0.493 0.361 0.262 9.5e-12
CGD|CAL0002871 556 orf19.4574 [Candida albicans ( 0.301 0.163 0.355 5.9e-09
UNIPROTKB|Q5AMS2 556 CaO19.12043 "Putative uncharac 0.301 0.163 0.355 5.9e-09
POMBASE|SPAC4A8.10 785 SPAC4A8.10 "lipase (predicted) 0.304 0.117 0.358 7.6e-08
SGD|S000002267 647 YDL109C "Putative lipase" [Sac 0.298 0.139 0.326 1.7e-07
TAIR|locus:2117527 AT4G25770 "AT4G25770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 600 (216.3 bits), Expect = 1.9e-58, P = 1.9e-58
 Identities = 139/286 (48%), Positives = 176/286 (61%)

Query:     3 VVKKTDSLKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRR 62
             VVK    LK+ISF+AHSLGGL ARYA+  LY    E+ GE VD  DS  +      S+R 
Sbjct:   154 VVKHRSGLKKISFVAHSLGGLVARYAIGKLY----EQPGE-VDSLDSPSKEK----SARG 204

Query:    63 GTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDG 122
             G IAGLEP+NFIT ATPHLG RG +Q P L G+ FLE+ A   A +  G+TG  LFL+D 
Sbjct:   205 GEIAGLEPMNFITFATPHLGSRGHRQFPILCGLPFLERTASQTAHLAAGRTGKHLFLVDN 264

Query:   123 RPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSIRRETELVKPPR 182
                  PLL+RMA+D +D KF+SAL AF+ R+ YANV++D MVGWRTSSIRR  EL KP  
Sbjct:   265 DDGNAPLLIRMATDSDDLKFISALNAFKRRVAYANVNFDSMVGWRTSSIRRPNELPKPNL 324

Query:   183 RSLD-GYKHVVDVEYCPPVSSDGPHFTSEAIKAKEAAQNEPNAQNTSEYHVIMEEEMIRG 241
              + D  Y H+V VE    V +     TS  +            Q+T      +EEEMI G
Sbjct:   325 LATDPNYPHIVYVER-GNVDNGSCQSTSTVV----------TEQDTD-----LEEEMIHG 368

Query:   242 LQRLGWKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVAD 287
             L +L W++VDVSFH++   + AH+ I VK  WLH+ G  V+ H+ D
Sbjct:   369 LSQLSWERVDVSFHNSKQRYVAHSTIQVKTYWLHSDGKDVVFHMMD 414
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2176172 AT5G51180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201901 AT1G10040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0005636 orf19.4128 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59KL3 CaO19.4128 "Potential lipid particle serine esterase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0275671 DDB_G0275671 "esterase/lipase/thioesterase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0002871 orf19.4574 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AMS2 CaO19.12043 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
POMBASE|SPAC4A8.10 SPAC4A8.10 "lipase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000002267 YDL109C "Putative lipase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
pfam05057214 pfam05057, DUF676, Putative serine esterase (DUF67 3e-45
>gnl|CDD|218405 pfam05057, DUF676, Putative serine esterase (DUF676) Back     alignment and domain information 
 Score =  152 bits (385), Expect = 3e-45
 Identities = 73/171 (42%), Positives = 96/171 (56%), Gaps = 21/171 (12%)

Query: 1   MEVVKKTDSLKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSS 60
           +E V+     K+ISF+ HSLGGL ARYA+  LY S                     M ++
Sbjct: 65  LEFVQDGSDGKKISFVGHSLGGLIARYAIGKLYDSA--------------------MSTT 104

Query: 61  RRGTIAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLFLM 120
            +G   GLEP+NFITLA+PHLGV G   L    G+ FLEKL   L+   +G+TG  LFL 
Sbjct: 105 FKGFFKGLEPMNFITLASPHLGVLGNSPLINW-GLWFLEKLKKSLSMGQLGKTGRDLFLK 163

Query: 121 DGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWRTSSI 171
           D       LL ++ +D  D KF+SALGAF+ RI+YANV  D++    TS +
Sbjct: 164 DVYDGINSLLYKLLTDESDLKFISALGAFKRRILYANVVNDYIAPLYTSKL 214

This family of proteins are probably serine esterase type enzymes with an alpha/beta hydrolase fold. Length = 214

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 302
KOG4372405 consensus Predicted alpha/beta hydrolase [General 100.0
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 100.0
KOG4372405 consensus Predicted alpha/beta hydrolase [General 99.14
KOG2205424 consensus Uncharacterized conserved protein [Funct 98.95
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.5
PLN02633314 palmitoyl protein thioesterase family protein 97.88
PLN02606306 palmitoyl-protein thioesterase 97.86
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 97.85
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 97.75
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 97.74
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 97.6
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 97.34
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 97.13
KOG3724 973 consensus Negative regulator of COPII vesicle form 97.04
COG1075336 LipA Predicted acetyltransferases and hydrolases w 96.98
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 96.87
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 96.72
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 96.37
PLN02454414 triacylglycerol lipase 96.1
PLN02408365 phospholipase A1 95.95
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 95.66
PLN03037525 lipase class 3 family protein; Provisional 95.63
PLN02802509 triacylglycerol lipase 95.62
PLN02324415 triacylglycerol lipase 95.55
PLN02571413 triacylglycerol lipase 95.47
KOG2029697 consensus Uncharacterized conserved protein [Funct 95.41
PLN02310405 triacylglycerol lipase 95.24
PLN02753531 triacylglycerol lipase 95.18
PLN02719518 triacylglycerol lipase 95.12
PLN02211273 methyl indole-3-acetate methyltransferase 94.8
PLN02761527 lipase class 3 family protein 94.66
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 94.39
PRK10985324 putative hydrolase; Provisional 94.22
COG4814288 Uncharacterized protein with an alpha/beta hydrola 93.95
PLN02934515 triacylglycerol lipase 93.95
PLN00413479 triacylglycerol lipase 93.7
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 93.68
PLN02965255 Probable pheophorbidase 93.54
KOG2369473 consensus Lecithin:cholesterol acyltransferase (LC 93.31
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 93.13
PLN02162475 triacylglycerol lipase 93.06
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 92.81
PRK00870302 haloalkane dehalogenase; Provisional 92.73
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 92.73
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 92.72
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 92.63
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 92.56
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 92.47
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 92.46
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 92.36
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 92.02
PRK10749330 lysophospholipase L2; Provisional 91.84
TIGR03611257 RutD pyrimidine utilization protein D. This protei 91.79
PRK10349256 carboxylesterase BioH; Provisional 91.65
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 91.64
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 91.53
PRK10673255 acyl-CoA esterase; Provisional 91.52
PHA02857276 monoglyceride lipase; Provisional 91.38
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 91.25
PRK03204286 haloalkane dehalogenase; Provisional 90.84
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 90.69
PLN02824294 hydrolase, alpha/beta fold family protein 90.64
COG2267298 PldB Lysophospholipase [Lipid metabolism] 90.36
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 90.32
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 90.28
PRK11071190 esterase YqiA; Provisional 89.32
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 89.25
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 89.25
PRK03592295 haloalkane dehalogenase; Provisional 89.12
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 88.82
PLN02847633 triacylglycerol lipase 88.65
PRK10566249 esterase; Provisional 88.4
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 88.38
PRK08775343 homoserine O-acetyltransferase; Provisional 88.33
PLN02298330 hydrolase, alpha/beta fold family protein 88.32
PLN02894402 hydrolase, alpha/beta fold family protein 87.78
PLN02578354 hydrolase 87.72
COG4782377 Uncharacterized protein conserved in bacteria [Fun 87.13
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 87.12
COG2819264 Predicted hydrolase of the alpha/beta superfamily 86.95
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 86.72
PLN02679360 hydrolase, alpha/beta fold family protein 86.38
PLN02385349 hydrolase; alpha/beta fold family protein 86.38
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 85.97
PRK06489360 hypothetical protein; Provisional 85.57
PRK13604307 luxD acyl transferase; Provisional 85.44
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 85.31
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 84.94
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 84.78
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 84.38
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 83.72
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 83.28
PRK07581339 hypothetical protein; Validated 83.24
PLN00021313 chlorophyllase 82.84
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 82.79
KOG2564343 consensus Predicted acetyltransferases and hydrola 82.36
PLN02652395 hydrolase; alpha/beta fold family protein 82.23
PRK00175379 metX homoserine O-acetyltransferase; Provisional 80.86
COG3208244 GrsT Predicted thioesterase involved in non-riboso 80.76
KOG4569336 consensus Predicted lipase [Lipid transport and me 80.48
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 80.19
>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=9.1e-39  Score=308.84  Aligned_cols=255  Identities=35%  Similarity=0.437  Sum_probs=199.9

Q ss_pred             CCceEEEEeecchhHHHHHHHHHHhccccccCCCCccccccccccccccccccCCccccccceeeEEecCC-CCCccCCC
Q 022151            9 SLKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRRGTIAGLEPVNFITLATP-HLGVRGKK   87 (302)
Q Consensus         9 ~~~kISfVGHSLGGLiaRyAi~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~i~~l~p~nFITlATP-HLG~~~~~   87 (302)
                      ++.||||||||||||++||||++||..........+...+       ....+..+.|+|++|++|||.||| |||++|++
T Consensus       148 si~kISfvghSLGGLvar~AIgyly~~~~~~f~~v~p~~f-------itlasp~~gIagleP~yii~~at~~~LG~tG~k  220 (405)
T KOG4372|consen  148 SIEKISFVGHSLGGLVARYAIGYLYEKAPDFFSDVEPVNF-------ITLASPKLGIAGLEPMYIITLATPGHLGRTGQK  220 (405)
T ss_pred             ccceeeeeeeecCCeeeeEEEEeecccccccccccCcchh-------hhhcCCCccccccCchhhhhhhcHHHHhhhccc
Confidence            4799999999999999999999999964221110000011       111123588999999999999999 99999999


Q ss_pred             CCcccchhHHHHHhhhhhhhhhhcccccccccccCCCCCcchhhhcccCCCCchHHHHhhccceEEEEecCCCCeeeeee
Q 022151           88 QLPFLFGVSFLEKLALPLAPILVGQTGSQLFLMDGRPDKPPLLLRMASDCEDGKFLSALGAFRCRIVYANVSYDHMVGWR  167 (302)
Q Consensus        88 ~~p~~~G~~~l~k~a~~~~~~~~g~TG~qL~L~D~~~~~~pLL~~m~~d~~~~~f~~aL~~Fk~RvlyaN~~~D~~Vp~~  167 (302)
                      |.|+++|+++.+++|...    .|+||.+||+.|.....+||+.||+.+..+.+|+.||..|+.+++|.|...|+++   
T Consensus       221 q~l~~~g~~~~e~~a~~~----~~~~l~~L~~~d~~~~l~~fkrR~~~an~~nd~Ival~t~~~~~l~~~~~~~~~~---  293 (405)
T KOG4372|consen  221 QVLFLFGLTFLEKLAANI----SKRTLEHLFLADLKEVLPPFKRRMAYANEDNDFIVALYTAALLVLDWNKIHDRLL---  293 (405)
T ss_pred             ccccccCCcchhhhcccc----cchhhhhhccCchhhhhhHHHHHHHhhccccccchhhHHHHHHhcchhhhHHhhh---
Confidence            999999999999988654    7899999999998888889999999888888899999999999999999898888   


Q ss_pred             cccccccCCCCCCC-CCcCCCCCceeeccCCCCCCCCCCCCChhHHHHHHHhhcCCCCCCchhhhHhhHHHHHhcccccc
Q 022151          168 TSSIRRETELVKPP-RRSLDGYKHVVDVEYCPPVSSDGPHFTSEAIKAKEAAQNEPNAQNTSEYHVIMEEEMIRGLQRLG  246 (302)
Q Consensus       168 TssI~~~~~l~~~~-~~~~~~y~hiv~~~~~~~~~s~~~~f~~~~~~~~~~a~~~p~~~~~~~~~~~lee~m~r~l~~l~  246 (302)
                      |....+.+++++.. ...+++|+|+++++.+.+         +..+..+.+.+    ..+.+..-..++|.|+..|....
T Consensus       294 ~~~~~~~~~l~~~~~~~~ne~~p~~~~~~a~~~---------~~~a~~~~~~~----e~~~d~~~~~~~~~~~~~l~~~~  360 (405)
T KOG4372|consen  294 TFEESRPSPLPKGQSSPINEKYPHIVNVEAPTK---------PSKALKSWGRT----ENNSDIKNVSNEESMASSLTSPC  360 (405)
T ss_pred             cccccCCCcccccccCCccccCCccccccCCCc---------hhhhhcccccc----ccccchhhhhhhhhhhhhhcccC
Confidence            55555666666644 356689999998875422         22122222221    00111111346899999999999


Q ss_pred             eEEEEEeecCCCCCccceeeEEEecccccccChhHHHHHHHHHh
Q 022151          247 WKKVDVSFHSAFWPFFAHNNIHVKNEWLHNAGTGVIAHVADSLR  290 (302)
Q Consensus       247 W~kVdV~f~~~~~~~~AHn~I~vk~~~~n~~G~~Vi~H~~d~~~  290 (302)
                      |+||+++|+..++++.+|+.|+++..-.+.+|.++|.|++++|.
T Consensus       361 ~~r~~~s~~~~~~~~~~hd~i~~~~~~~~~~~~~~~~~~~~~~~  404 (405)
T KOG4372|consen  361 PERVYISFPDLRQPVVIHDKIYVKLKLPPPEGADEIGHIAKKFI  404 (405)
T ss_pred             chhhhccCcchhcceecccceeeeccCCCCcccccccchhhhcC
Confidence            99999999999999999999999999999999999999999875

>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2205 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>KOG2029 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.33
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 98.26
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 97.93
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 97.74
3lp5_A250 Putative cell surface hydrolase; structural genom 97.74
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 97.69
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 97.44
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 97.32
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 97.1
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 96.99
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 96.93
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 96.9
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 96.88
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 96.74
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 96.72
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 96.61
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 96.33
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 96.23
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 96.09
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 95.73
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 95.67
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 95.13
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 95.09
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 94.98
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 94.97
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 94.91
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 94.89
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 94.57
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 94.5
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 94.3
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 94.21
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 94.2
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 94.18
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 94.03
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 94.02
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 93.96
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 93.92
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 93.87
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 93.86
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 93.82
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 93.81
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 93.79
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 93.79
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 93.74
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 93.57
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 93.57
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 93.56
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 93.51
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 93.47
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 93.44
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 93.43
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 93.4
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 93.38
1iup_A282 META-cleavage product hydrolase; aromatic compound 93.35
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 93.34
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 93.3
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 93.21
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 92.34
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 93.15
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 93.14
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 93.09
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 93.08
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 93.06
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 92.97
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 92.95
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 92.93
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 92.87
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 92.83
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 92.77
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 92.76
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 92.7
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 92.67
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 92.64
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 92.6
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 92.6
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 92.45
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 92.41
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 92.4
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 92.37
1r3d_A264 Conserved hypothetical protein VC1974; structural 92.34
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 92.17
3h04_A275 Uncharacterized protein; protein with unknown func 92.16
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 92.11
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 91.98
4fle_A202 Esterase; structural genomics, PSI-biology, northe 91.96
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 91.93
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 91.9
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 91.88
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 91.86
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 91.76
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 91.74
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 91.72
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 91.7
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 91.63
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 91.58
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 91.5
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 91.37
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 91.21
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 91.13
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 91.02
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 90.98
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 90.96
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 90.95
3tej_A329 Enterobactin synthase component F; nonribosomal pe 90.92
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 90.86
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 90.85
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 90.8
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 90.76
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 90.74
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 90.74
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 90.67
3llc_A270 Putative hydrolase; structural genomics, joint cen 90.57
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 90.52
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 90.48
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 90.46
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 90.4
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 89.91
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 89.79
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 89.74
1kez_A300 Erythronolide synthase; polyketide synthase, modul 89.58
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 89.57
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 89.32
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 89.24
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 89.16
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 89.07
1vkh_A273 Putative serine hydrolase; structural genomics, jo 89.06
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 89.01
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 88.97
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 88.93
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 88.78
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 88.67
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 88.61
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 88.46
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 88.45
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 88.27
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 88.0
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 88.21
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 88.21
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 88.16
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 87.97
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 87.85
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 87.83
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 87.67
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 87.54
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 87.27
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 87.11
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 87.1
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 87.08
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 87.06
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 87.04
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 87.04
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 87.04
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 86.96
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 86.77
3bjr_A283 Putative carboxylesterase; structural genomics, jo 86.75
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 86.75
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 86.63
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 86.55
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 86.36
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 86.33
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 86.18
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 86.14
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 86.14
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 85.87
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 85.86
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 85.78
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 85.26
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 84.94
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 84.67
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 84.45
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 84.15
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 83.95
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 83.93
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 83.7
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 83.51
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 83.35
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 83.28
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 83.17
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 83.0
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 82.95
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 82.86
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 82.75
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 82.72
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 82.39
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 82.31
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 82.14
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 81.32
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 81.03
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
Probab=98.33  E-value=1.8e-06  Score=78.93  Aligned_cols=44  Identities=30%  Similarity=0.356  Sum_probs=34.9

Q ss_pred             ceEEEEeecchhHHHHHHHHHHhccccccCCCCccccccccccccccccccCCccccccceeeEEecCCCCCccCCC
Q 022151           11 KRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRRGTIAGLEPVNFITLATPHLGVRGKK   87 (302)
Q Consensus        11 ~kISfVGHSLGGLiaRyAi~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~i~~l~p~nFITlATPHLG~~~~~   87 (302)
                      .++.+|||||||+++|+++... ..                                ....++|++++||.|+.+..
T Consensus        80 ~~~~lvGhSmGG~ia~~~a~~~-~~--------------------------------~~v~~lv~~~~p~~g~~~~~  123 (279)
T 1ei9_A           80 QGYNAMGFSQGGQFLRAVAQRC-PS--------------------------------PPMVNLISVGGQHQGVFGLP  123 (279)
T ss_dssp             TCEEEEEETTHHHHHHHHHHHC-CS--------------------------------SCEEEEEEESCCTTCBCSCT
T ss_pred             CCEEEEEECHHHHHHHHHHHHc-CC--------------------------------cccceEEEecCccCCccCCC
Confidence            7999999999999999998652 11                                01247899999999998654
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 302
d1ku0a_388 c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophi 0.001
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Length = 388 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Bacterial lipase
domain: Lipase L1
species: Bacillus stearothermophilus [TaxId: 1422]

 Score = 38.2 bits (88), Expect = 0.001
 Identities = 26/114 (22%), Positives = 46/114 (40%), Gaps = 9/114 (7%)

Query: 5   KKTDSLKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRRGT 64
            +     R+  +AHS GG  AR  V++L + + EE        +  +E+++++     G 
Sbjct: 99  PELKRGGRVHIIAHSQGGQTARMLVSLLENGSQEER-------EYAKEHNVSLSPLFEGG 151

Query: 65  IAGLEPVNFITLATPHLGVRGKKQLPFLFGVSFLEKLALPLAPILVGQTGSQLF 118
              +  V   T+ATPH G      + F      L+K  L  A +      +   
Sbjct: 152 HRFVLSV--TTIATPHDGTTLVNMVDFTDRFFDLQKAVLEAAAVASNAPYTSEI 203

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 99.28
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.36
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.29
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 98.25
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.21
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.96
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 97.11
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 96.61
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 96.36
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 96.2
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 96.14
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 95.81
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 94.43
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 94.33
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 94.31
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 93.62
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 93.56
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 93.28
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 93.17
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 92.79
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 92.51
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 92.49
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 92.26
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 92.04
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 91.95
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 91.55
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 91.0
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 90.91
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 90.33
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 90.11
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 90.01
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 89.42
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 89.27
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 89.17
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 89.16
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 89.0
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 88.79
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 88.78
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 88.71
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 88.27
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 87.86
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 86.54
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 85.91
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 80.02
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Thioesterases
domain: Palmitoyl protein thioesterase 1
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.28  E-value=4.4e-12  Score=115.98  Aligned_cols=137  Identities=18%  Similarity=0.128  Sum_probs=79.2

Q ss_pred             ccccCC-CceEEEEeecchhHHHHHHHHHHhccccccCCCCccccccccccccccccccCCccccccceeeEEecCCCCC
Q 022151            4 VKKTDS-LKRISFLAHSLGGLFARYAVAVLYSSTAEESGEPVDLADSMRENSLTMCSSRRGTIAGLEPVNFITLATPHLG   82 (302)
Q Consensus         4 i~~~p~-~~kISfVGHSLGGLiaRyAi~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~i~~l~p~nFITlATPHLG   82 (302)
                      +++.+. ..+|++||||||||++|+++.++...                                 ...+||||||||.|
T Consensus        72 I~~~~~~~~~v~lVGhSqGGLiaR~~i~~~~~~---------------------------------~V~~lITLgsPH~G  118 (279)
T d1ei9a_          72 LAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSP---------------------------------PMVNLISVGGQHQG  118 (279)
T ss_dssp             HHSCGGGTTCEEEEEETTHHHHHHHHHHHCCSS---------------------------------CEEEEEEESCCTTC
T ss_pred             HHhccccccceeEEEEccccHHHHHHHHHcCCC---------------------------------CcceEEEECCCCCC
Confidence            344443 35899999999999999999764221                                 23699999999999


Q ss_pred             ccCCCCCcccchh--HHHHHhhhhhhh-hhhcccccc-cccccCCC-----CCcchhhhcccCC-CCchHHHHhhccceE
Q 022151           83 VRGKKQLPFLFGV--SFLEKLALPLAP-ILVGQTGSQ-LFLMDGRP-----DKPPLLLRMASDC-EDGKFLSALGAFRCR  152 (302)
Q Consensus        83 ~~~~~~~p~~~G~--~~l~k~a~~~~~-~~~g~TG~q-L~L~D~~~-----~~~pLL~~m~~d~-~~~~f~~aL~~Fk~R  152 (302)
                      +.+....+-..+.  +.+.+++...+. -++.+.-.+ =+..|-..     ....+|..+-.+. -+..+.+.|.+.++-
T Consensus       119 v~~~p~c~~~~~~~c~~~~~~l~~~~y~~~~Q~~l~~a~Yw~dp~~~~~Y~~~s~fL~~iNne~~~n~~~k~nl~~l~~~  198 (279)
T d1ei9a_         119 VFGLPRCPGESSHICDFIRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSIFLADINQERGVNESYKKNLMALKKF  198 (279)
T ss_dssp             BCSCTTCCSTTCHHHHHHHHHTHHHHTSHHHHHHCTGGGGBCCSTTHHHHHHHCSSHHHHTTTTSCCHHHHHHHHTSSEE
T ss_pred             ccCCccCCCcchhHHHHHHHHHHhhhhHHHHhhceeccchhcCcchHhhhhhhhhHHHHHhCCccCChHHHHHHHhhccE
Confidence            9974321111111  222222211110 011111000 11222110     0123555554431 134688999999999


Q ss_pred             EEEecCCCCeee-eeeccccccc
Q 022151          153 IVYANVSYDHMV-GWRTSSIRRE  174 (302)
Q Consensus       153 vlyaN~~~D~~V-p~~TssI~~~  174 (302)
                      |++.. .+|.+| ||.||-+.--
T Consensus       199 vli~~-~~D~vv~P~eSs~f~~y  220 (279)
T d1ei9a_         199 VMVKF-LNDTIVDPVDSEWFGFY  220 (279)
T ss_dssp             EEEEE-TTCSSSSSGGGGGTCEE
T ss_pred             EEEEe-CCCceECCCCcceeeec
Confidence            99987 588876 9999977543
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure