Citrus Sinensis ID: 022241

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MFRKTCSWIRDMGCCSCFGFTRRKPKQALRPITGLNYRISRDFLLGDDIDDDDDDNSYNGEATNTADGDGGEMQNHAKRSEEIFRERELNGLICRQFPVKESNKLIRSEDENGTKMINEYVHVRKIGAGSYGKVVLYRSSLDGKHYAIKAFHKSHLSKLRVAPSETAMTDVRREVLIMKMLQHPNIVNLIEVIDDPNSDHFYMVLEYVEGKWDNDGFGQPGAIGESMARKYLRDIVSGLMYLHGHNVVHGDIKPDNLLVAPSGTVKIGDFSVSQVFEDDNDVLRRSPGTPVFTAPECCLG
cccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccCCcccccccEEEccEEEEEEEEccccEEEEEEEEcccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEccccccEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEECcccccccccccccccccccccccccccccccc
****TCSWIRDMGCCSCFGFTRRKPKQALRPITGLNYRISRDFLLGD*******************************************************************KMINEYVHVRKIGAGSYGKVVLYRSSLDGKHYAIKAFHKSHLSKLRVAPSETAMTDVRREVLIMKMLQHPNIVNLIEVIDDPNSDHFYMVLEYVEGKWDNDGFGQPGAIGESMARKYLRDIVSGLMYLHGHNVVHGDIKPDNLLVAPSGTVKIGDFSVSQVFEDDNDVLRRSPGTPVFTAPECCLG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRKTCSWIRDMGCCSCFGFTRRKPKQALRPITGLNYRISRDFLLGDDIDDDDDDNSYNGEATNTADGDGGEMQNHAKRSEEIFRERELNGLICRQFPVKESNKLIRSEDENGTKMINEYVHVRKIGAGSYGKVVLYRSSLDGKHYAIKAFHKSHLSKLRVAPSETAMTDVRREVLIMKMLQHPNIVNLIEVIDDPNSDHFYMVLEYVEGKWDNDGFGQPGAIGESMARKYLRDIVSGLMYLHGHNVVHGDIKPDNLLVAPSGTVKIGDFSVSQVFEDDNDVLRRSPGTPVFTAPECCLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase GRIK2 Activates SnRK1.1/KIN10 and SnRK1.2/KIN11 by phosphorylation of their activation-loop 'Thr-198' and 'Thr-176', respectively. Required for the regulation by SnRK1 kinases of the transcription of a large set of genes, the modification the activity of metabolic enzymes, and the control of various nutrient-responsive cellular developmental processes.probableQ5HZ38

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I6U, chain A
Confidence level:very confident
Coverage over the Query: 2-277,290-299
View the alignment between query and template
View the model in PyMOL