Citrus Sinensis ID: 022242

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300

MDKNEEKQREEEREQVVSPWEVSSSGKIDYDKLIDKFGCQRLDQSLVDRVQRLTGRPPHVFLRRGVFFAHRDLNDILDAYEKGEKFYLYTGRGPSSEALHLGHLVPFMFTKYLQDAFKVPLVIQLTDDEKCMWKNLSVEESQRLARENAKDIIACGFDVTKTFIFSDFDYVGGAFYKNMVKVAKCVTYNKVVGIFGFTGEDHIGKVSFPPVQAVPSFPSSFPHLFSGKDHLRCLIPCAIDQDPYFRMTRDVAPRIGYHKPALIESSFFPALQGETGKMSASDPNSAIYVTDSAKAIKNKV

cccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHcccccccEEccCEcccccHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHcccHHHHHHHcccccccccccccccHHHccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEcccHHHHHHcc

****************VSPWEVSSSGKIDYDKLIDKFGCQRLDQSLVDRVQRLTGRPPHVFLRRGVFFAHRDLNDILDAYEKGEKFYLYTGRGPSSEALHLGHLVPFMFTKYLQDAFKVPLVIQLTDDEKCMWKNLSVEESQRLARENAKDIIACGFDVTKTFIFSDFDYVGGAFYKNMVKVAKCVTYNKVVGIFGFTGEDHIGKVSFPPVQAVPSFPSSFPHLFSGKDHLRCLIPCAIDQDPYFRMTRDVAPRIGYHKPALIESSFFPA***************AIYVTDSAKAIKNKV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tryptophan--tRNA ligase, cytoplasmic	T1-TrpRS has aminoacylation activity while T2-TrpRS lacks it. T1-TrpRS and T2-TrpRS possess angiostatic activity. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.	probable	Q6P7B0
Tryptophan--tRNA ligase, cytoplasmic	Isoform 1, isoform 2 and T1-TrpRS have aminoacylation activity while T2-TrpRS lacks it. Isoform 2, T1-TrpRS and T2-TrpRS possess angiostatic activity whereas isoform 1 lacks it. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.	probable	P23381
Tryptophan--tRNA ligase, cytoplasmic	T1-TrpRS has aminoacylation activity while T2-TrpRS lacks it. T1-TrpRS and T2-TrpRS possess angiostatic activity. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.	probable	P17248

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
6.-.-.-	Ligases.	probable
6.1.-.-	1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.	probable
6.1.1.-	Ligases forming aminoacyl-tRNA and related compounds.	probable
6.1.1.2	Tryptophan--tRNA ligase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R6T, chain A
Confidence level:very confident
Coverage over the Query: 14-300
View the alignment between query and template
View the model in PyMOL