Citrus Sinensis ID: 022260

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300

MLPYATIEDAAAALGRNLTFAETLWYNYSANKSDYFLYCHNILFLFLVFSVAPLPFVVIESLRSDSFDKYKIQPKVRLSFSEMVRCYKDVMRMFFLVVGPLQLVSFPSVQMVGIRTGLPLPSGWEILAQLVVYFMVEDYTNYWIHRFLHCKWGYEKIHRVHHEYTAPIGFAAPYAHWAEILILGIPSFLGPAMAPGHMITFWLWIALRQIEAIDTHSGYDFPWGFTKYIPFYGGADYHDYHHYVGEQSHSNFASVFTYCDFLYGTDKGYRYQKKLLRKMQEELRGSGEQNGGSYQNLKSE

ccccccHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccc

**PYATIEDAAAALGRNLTFAETLWYNYSANKSDYFLYCHNILFLFLVFSVAPLPFVVIESLRSDSFDKYKIQPKVRLSFSEMVRCYKDVMRMFFLVVGPLQLVSFPSVQMVGIRTGLPLPSGWEILAQLVVYFMVEDYTNYWIHRFLHCKWGYEKIHRVHHEYTAPIGFAAPYAHWAEILILGIPSFLGPAMAPGHMITFWLWIALRQIEAIDTHSGYDFPWGFTKYIPFYGGADYHDYHHYVGEQSHSNFASVFTYCDFLYGTDKGYRYQKKLL************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Methylsterol monooxygenase 1-2	Non-heme iron oxygenase involved in sterols biosynthesis. 4,4-dimethyl-9-beta,19-cyclopropylsterols such as 24-methylenecycloartanol are the preferred substratess.	confident	Q1EC69
Putative methylsterol monooxygenase DDB_G0270946		probable	Q55D52
Methylsterol monooxygenase 1-1	Non-heme iron oxygenase involved in sterols biosynthesis. 4,4-dimethyl-9-beta,19-cyclopropylsterols such as 24-methylenecycloartanol are the preferred substrates.	probable	Q8L7W5

Prediction of Enzyme Commission Number

No confident prediction of EC number!